KEGG   Enterobacter cloacae EcWSU1: EcWSU1_02058Help
Entry
EcWSU1_02058      CDS       T01652                                 

Gene name
paaF
Definition
(GenBank) putative enoyl-CoA hydratase paaF
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00071  Fatty acid degradation
eec00280  Valine, leucine and isoleucine degradation
eec00281  Geraniol degradation
eec00310  Lysine degradation
eec00360  Phenylalanine metabolism
eec00362  Benzoate degradation
eec00380  Tryptophan metabolism
eec00410  beta-Alanine metabolism
eec00627  Aminobenzoate degradation
eec00640  Propanoate metabolism
eec00650  Butanoate metabolism
eec00903  Limonene and pinene degradation
eec00930  Caprolactam degradation
eec01100  Metabolic pathways
eec01110  Biosynthesis of secondary metabolites
eec01120  Microbial metabolism in diverse environments
eec01130  Biosynthesis of antibiotics
eec01212  Fatty acid metabolism
Module
eec_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EcWSU1_02058 (paaF)
   00650 Butanoate metabolism
    EcWSU1_02058 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    EcWSU1_02058 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EcWSU1_02058 (paaF)
   00310 Lysine degradation
    EcWSU1_02058 (paaF)
   00360 Phenylalanine metabolism
    EcWSU1_02058 (paaF)
   00380 Tryptophan metabolism
    EcWSU1_02058 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EcWSU1_02058 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EcWSU1_02058 (paaF)
   00281 Geraniol degradation
    EcWSU1_02058 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EcWSU1_02058 (paaF)
   00627 Aminobenzoate degradation
    EcWSU1_02058 (paaF)
   00930 Caprolactam degradation
    EcWSU1_02058 (paaF)
Enzymes [BR:eec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EcWSU1_02058 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEW73495
UniProt: G8LNM9
Position
2116038..2116805
Genome map
AA seq 255 aa AA seqDB search
MSELMVTRHGRVLQLTLNRPAARNALNNALLEQIADALDAAAADRDLSVCVIYGNARCFA
AGADLNEMAEKDLPATLNDIRPQLWARINAFNKPLIAAVNGFALGAGCELALLCDVVIAG
DNARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLTGESITAQQAQRAGLVSDVFPA
SLTLEYALKQAALMARHSPLALQAAKQALRQSQEVSLQAGLVQERQLFTLLSATEDRREG
IDAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatggtcacccgtcatggtcgtgtcctgcagctgacgcttaaccgtccg
gcggcacgcaacgcgctgaataacgccctgttagagcagattgctgacgcgctcgacgcc
gctgcggccgatcgcgatctctccgtttgcgtgatttacggcaacgcacgctgctttgct
gccggcgcagatctcaacgaaatggcggagaaagacctgcctgccaccctgaacgatatc
cgtccccagctgtgggcccggatcaacgccttcaacaaacccctgattgccgccgtcaac
ggcttcgcgctgggcgcgggctgcgagcttgcgctgctgtgcgacgtggtgattgccggg
gataacgcccgttttggtctgccggaaattacgctcggcatcatgcccggggcgggcggt
acgcagcgactgattcgtagcgtgggcaaatcgctggccagcaaaatggtgctgaccggg
gagagcattaccgcgcagcaggcgcagcgcgccgggctggtcagcgatgtgttcccggct
tcattgacgctggaatatgccctgaaacaggcggcgctgatggctcgacactcaccgctg
gcgctccaggcggcaaagcaggcgctgcgccagtctcaggaggtttccctgcaggccgga
ctggtccaggagcgacagctgtttacgctgctttcagcgaccgaagaccggcgagaaggc
atcgacgcattcttacagaaacgtacccccgactttaaaggacgctaa

DBGET integrated database retrieval system