KEGG   Enterobacter cloacae EcWSU1: EcWSU1_02267Help
Entry
EcWSU1_02267      CDS       T01652                                 

Gene name
arrD
Definition
lysozyme from lambdoid prophage DLP12
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eec  Enterobacter cloacae EcWSU1
Brite
Enzymes [BR:eec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     EcWSU1_02267 (arrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2333962..2334471)
Genome map
AA seq 169 aa AA seqDB search
MKSIVKRCSVAAVLALAALLPDFRLLNTSPEGLALIADLEGCRLTPYQCSAGVWTSGIGH
TAGVVPKGEITERQAAANLVADVMTVEKRLAVCAPVEMPQHVYDALVSFSFNVGTGAACR
STLVSYIKRHQWWQACDQLTRWVYVNGKVSTGLENRRARERAYCIRGIQ
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatcaatcgttaaacgttgcagtgtggccgcagtgctggcgctggcggcgctgttg
cctgactttcgtctgcttaacacctcgcccgaggggctggcgctgattgccgacctcgaa
ggttgtcgcctgacgccttaccagtgcagcgcgggagtgtggacgtcaggcatcggccac
actgcaggcgtcgtcccgaaaggggaaatcaccgagcgtcaggcggcggcgaaccttgtc
gcggatgtgatgaccgtcgagaaacgtctcgcggtctgtgcgccggtagaaatgccgcag
cacgtttacgacgcgctggtcagcttctcattcaacgtgggaaccggcgcggcctgccgc
tcaacgctggtctcgtacatcaagcgtcatcaatggtggcaggcgtgcgaccagctcacc
cgctgggtttatgtgaatggcaaagtcagcaccgggctggaaaatcgccgcgcgcgtgag
cgtgcctactgcatcaggggaattcaatga

DBGET integrated database retrieval system