KEGG   Enterobacter cloacae EcWSU1: EcWSU1_02283Help
Entry
EcWSU1_02283      CDS       T01652                                 

Gene name
scrB
Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00052  Galactose metabolism
eec00500  Starch and sucrose metabolism
eec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EcWSU1_02283 (scrB)
   00500 Starch and sucrose metabolism
    EcWSU1_02283 (scrB)
Enzymes [BR:eec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     EcWSU1_02283 (scrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 Reg_prop
Motif
Other DBs
NCBI-ProteinID: AEW73718
UniProt: G8LQ70
Position
complement(2351166..2352572)
Genome map
AA seq 468 aa AA seqDB search
MTLPSRWPAILQAVMKGQPRAYADSHYPQWHPAPVTGLMNDPNGFIWFAGRYHLFYQWNP
LDCDHRYKCWGHWSSADLVHWQHEPMALMPDEEYDRNGCYSGSAVDNNGVLTLCYTGNVK
FDDGSRTAWQCLATQQPDGTFKKLGRVLALPEGYTGHVRDPKVWQHDGVWFMVLGAQDLQ
KRGKVLLFTSADLHHWASCGEIAGHGVNGLTEAGYMWECPDLFALDGTHVLICCPQGLAR
EPHRYLNTYPAAWMSGAFDHTRATFKHGELHELDAGFEFYAPQTTVAEDGRRILIGWMGV
PDGEEMLQPTRAQGWVHQMTCPRELHFRDGKLWQTPVRELHALREEECRWQGNASDAPAL
DATRLEFELTSSSVTVDFAGALRLIVEDSGLRLERASLKTGETLTRYWRGDVHHLRVLCD
SSSVEIFINHGEGVMSSRYFPDHPARVRFEGGSDITLRYWSLRGCMVE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaccttcccgctggcctgccatcctgcaggccgtcatgaaaggccagccgcgt
gcgtacgccgacagccattatccgcaatggcatccggcaccggtgacggggctgatgaac
gatcctaacgggtttatctggtttgccgggcgttaccacctgttctatcagtggaacccg
ctggattgcgaccatcgctataagtgctggggacactggagttccgcagacctggtgcac
tggcagcacgaaccgatggcgctgatgcccgatgaggagtatgaccgcaacggctgctat
tccggcagcgccgtcgataacaacggtgtcctgacgttgtgttataccggcaacgtgaaa
tttgatgatggcagccgcaccgcctggcagtgccttgccacgcaacagcccgacggtaca
ttcaaaaaactcggtcgggttcttgcgctgccggaaggctacaccgggcacgtgcgtgac
ccgaaagtgtggcagcacgacggggtgtggttcatggtactgggggcgcaggatctgcaa
aaacgcggcaaggtgctgctgttcacatctgccgatttgcaccactgggcgtcttgcgga
gagattgccggtcatggcgtgaacggcctgaccgaggcgggatacatgtgggagtgcccg
gacctgtttgccctcgacgggacacacgtactgatctgctgtccgcaggggctggcgcgc
gaaccgcatcgctatctcaatacttatccggccgcgtggatgagcggggcgttcgaccat
acccgcgctacatttaaacatggcgagttgcacgagctggacgccggtttcgagttctac
gctccccaaaccacggtggcggaagacggacggcggatcctgatcggctggatgggcgtg
ccggacggagaagagatgcttcagccaacacgggcgcaagggtgggtccatcagatgacc
tgcccgcgagaattacacttccgtgacggcaaactgtggcagacgccggtgcgcgaactg
cacgcactgcgtgaagaggaatgtcgctggcagggtaacgccagcgatgccccggctctt
gatgcgacgcgccttgagttcgagctcacctcatcttcagtaaccgtggatttcgccggt
gcattgcgccttatcgtcgaggacagcgggttgcgtctggaacgcgccagcctgaaaacc
ggggagacattgacccgttactggcggggcgacgttcatcatttacgcgttctgtgtgac
agctccagcgttgaaattttcatcaatcatggcgaaggggtgatgagtagccgctatttt
cctgaccatccggcacgggtgcgattcgaaggtgggtccgacatcacattacgctactgg
tcgctgcgcggctgcatggtagaataa

DBGET integrated database retrieval system