KEGG   Enterobacter cloacae EcWSU1: EcWSU1_02309Help
Entry
EcWSU1_02309      CDS       T01652                                 

Gene name
adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EcWSU1_02309 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcWSU1_02309 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    EcWSU1_02309 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    EcWSU1_02309 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EcWSU1_02309 (adhP)
   00626 Naphthalene degradation
    EcWSU1_02309 (adhP)
Enzymes [BR:eec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EcWSU1_02309 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2377573..2378616
Genome map
AA seq 347 aa AA seqDB search
MQNLIMNKEKHMKAAVVTQDHQVNVTEKSLRPLKHGEALLKMECCGVCHTDLHVKNGDFG
DKTGVILGHEGIGIVKEIGPGVNSLKIGDRASVAWFFEGCGHCEYCNTGNETLCRDVKNA
GYSVDGGMAEECIVTADYAVKVPDGLDSAAASSITCAGVTTYKAVKVSHIKPGQWIAIYG
LGGLGNLALQYAKNVFNAKVIAIDVNDEQLKLAASMGADLTINSRSEDAAKIVQEKTGGA
HAAVVTAVAKAAFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIQVVGSLVGTRQD
LMEAFQFAAEGKVVPKVTMRPLEDINAIFKEMEQGQIRGRMVIDLRS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatctcatcatgaacaaggagaaacatatgaaggctgctgttgtcactcaggat
catcaggtcaatgtcaccgaaaaatcattacgtccgcttaagcatggagaagccctgctg
aagatggaatgctgcggcgtatgtcataccgatcttcacgtgaagaacggtgatttcggc
gataagaccggggtgatcctgggtcacgaaggaatagggatcgttaaagagattggccca
ggcgtcaactcgctgaaaattggcgaccgtgcgagcgtggcatggttttttgaaggctgt
ggacactgcgaatactgtaataccggcaacgaaaccctgtgccgcgatgtgaaaaacgcg
ggttattccgtggacggtgggatggctgaagagtgcatcgtgaccgccgattatgcggta
aaagtgccggacggtctggattccgcagcggcgagcagcatcacctgcgcgggggtcacc
acctacaaagcggtaaaagtgtcccacattaagccgggccagtggattgcgatttacggc
cttggtggtctgggtaaccttgcgttgcagtacgctaaaaacgtgttcaacgccaaggtc
atcgccattgatgtgaacgatgaacagctgaaactggccgccagcatgggggcagattta
accattaactctcgcagcgaagatgcagcgaaaattgttcaggagaaaaccggaggcgca
catgctgcggtggtaactgccgtggcaaaagcagccttcaactcagcggtggatgccgtg
cgtgccggtggccgcgtggtcgccgtgggcctgccgccggaagcgatgagcctggatatt
ccacgcctggttctggacggcattcaggttgtcggttcgctggtgggaacccgtcaggac
ctgatggaggcattccagtttgcggcagagggcaaagtggtgccaaaagtgacaatgcgt
ccgctggaagatatcaatgccatctttaaagagatggagcagggtcaaatccgtggtcgt
atggtgattgatttacgctcttaa

DBGET integrated database retrieval system