KEGG   Enterobacter cloacae EcWSU1: EcWSU1_02474Help
Entry
EcWSU1_02474      CDS       T01652                                 

Gene name
ycjM
Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:eec00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2553081..2554778)
Genome map
AA seq 565 aa AA seqDB search
MENKMQAKIKEIINLVYGESFSDTHFSVLLEKIDNAISVITDKRKMGWDEKDVVLITYAD
QFSAEGEKALPVFTRFYNKWLSHSFSHVHLLPFYPWSSDDGFSVIDYHDVAPETGTWQDI
AELKQSASLMFDFVCNHMSAQSQWFANYLKQMPGYNDFFISVDPETDLSAVTRPRALPLL
TPFTLHDGSVRHLWTTFSSDQVDLNFASPQVLIAMVDVLLHYLTEGARYIRLDAVGFMWK
IPGTSCIHLEQTHQLIQLFRAITEAVAPGTVIITETNVPHKDNVAYFGDGNNEAQMVYQF
SLPPLVLHAVHRQDVRALCQWASSLTLPSTKTTWFNFLASHDGIGLNPLRGILPESEILS
LVEKLQAEGALVNWKNNPDGTRSPYEINVTYLDALSTRDCDDNHRIARFILAHAVLLSFP
GVPAVYIQSILGSRNDYEGVERLGYNRAINRKKYLAGAIDSELENENSLRQKVYYRLREL
ISLRRAEKAFHPDSQACFSTAGEHVLKIMRIAQSGEKVTALFNFSDRVQTLESNIPSGRE
LIAGKDITGTTLTLNPWQVLWIKEN
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaaatgcaggctaaaattaaagaaatcattaatcttgtttacggggaatca
ttttccgatacccatttttcggtgttgctggaaaagattgataacgcgatttctgttatt
acagataagcgtaagatggggtgggatgaaaaagatgttgtcctgattacgtatgccgat
cagttttcggcagaaggggagaaagccctgccggttttcacacggttttataataagtgg
ctctctcactccttttcacatgttcatcttttacctttttatccgtggtcttctgacgac
ggtttttctgttattgattaccacgacgtcgcaccggaaacaggaacgtggcaggacatt
gccgaattaaaacaatcagccagtttgatgtttgatttcgtctgcaatcacatgtcggcg
caaagtcaatggttcgcgaattaccttaagcaaatgccggggtataacgatttcttcatt
tctgttgaccctgaaacggatctgtcggccgtcacgcgaccgcgtgctttgcccctcctc
acgccgtttacgcttcacgatggcagcgtacgccacctgtggaccaccttcagcagcgac
caggtcgatctcaattttgcctctcctcaggttctgattgcgatggtagacgtgctgctg
cactacctgactgaaggggcgcgctacattcgtttggatgccgttgggtttatgtggaag
atacccggaacgagctgtatccatctggaacaaacccatcagcttatccagcttttccgt
gccattaccgaggctgtcgcgccgggtacggtgataatcactgagaccaatgtcccgcat
aaagacaacgttgcctactttggtgatggcaacaatgaagcgcagatggtgtatcagttc
tccttgccgccgcttgtgctgcatgcggtacaccgtcaggatgtccgggcgctgtgtcag
tgggcgtcgtcgttgacacttccttccacgaaaaccacctggtttaactttttggcctcg
catgacgggattggcctcaatccgttacgcggaattttacccgagtctgagatcctctcg
ctggtagagaaacttcaggccgagggggcgctggtcaactggaaaaacaatccggatgga
acgcgaagcccgtatgaaatcaatgtcacttatcttgatgcgttaagcacaagggactgc
gatgacaatcaccgtattgcccggtttattcttgctcatgctgtactcctgagtttcccc
ggtgtgcctgccgtctatattcaaagtattcttggctcgcgtaatgattatgagggcgtg
gagcgcctgggatataaccgtgcgattaaccgcaaaaaatacctcgccggtgcaatcgac
agtgaacttgagaatgaaaatagcctgcggcagaaagtctattatagattgcgtgaatta
atctccctgaggcgtgcagaaaaagcattccaccctgacagtcaggcttgttttagtacg
gcaggcgagcatgtattaaaaataatgcgtattgcgcaaagtggcgaaaaagttaccgcg
ttatttaatttcagcgatcgcgttcaaacgcttgagtcaaatattccatccggcagggaa
ttgatcgccgggaaagatattactggtacgactctgacccttaatccatggcaggtgttg
tggattaaagaaaactaa

DBGET integrated database retrieval system