KEGG   Enterobacter cloacae EcWSU1: EcWSU1_02504Help
Entry
EcWSU1_02504      CDS       T01652                                 

Gene name
ribA
Definition
GTP cyclohydrolase-2
Orthology
K01497  
GTP cyclohydrolase II [EC:3.5.4.25]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Riboflavin metabolism
Metabolic pathways
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Class
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:eec00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2580770..2581360
Genome map
AA seq 196 aa AA seqDB search
MQLKRVAEAKLPTPWGDFLMVGFEELATGQDHVALVFGDISGQTPVLSRVHSECLTGDAL
FSLRCDCGFQLEAALSHIAEEGRGVLLYHRQEGRNIGLLNKIRAYALQDQGYDTVEANHQ
LGFAADERDFTLCADMFKLLGVDEVRLLTNNPKKVEILTEAGINIVERVPLIVGRNPKNA
HYLDTKAAKMGHLLSE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttaaacgtgtggcagaagccaaactgccaaccccatggggcgatttcctgatg
gtgggatttgaagaactggcaaccggacaggatcatgtcgcgctggtgttcggtgacatt
tcaggacagacgccggtactctctcgcgtacattcggagtgtctgactggcgatgccttg
ttcagcctgcgctgtgattgcggtttccagcttgaagcagccctttctcacatcgctgaa
gaaggtcgtggggtgctgctttatcaccgtcaggaaggtcgtaatattggcctgctgaat
aaaatccgcgcctacgcgctgcaggatcagggatacgatacggttgaagcgaaccaccag
ctcgggttcgccgccgatgagcgcgactttaccctgtgcgccgatatgttcaagcttctt
ggggtagatgaggtccgtctgctgaccaataacccgaaaaaggtggaaatcctgaccgaa
gcggggatcaatatcgtcgaacgtgttccgctgattgtcggccgtaacccgaaaaatgcc
cactatcttgataccaaagccgccaaaatgggtcacctcctgagcgagtga

DBGET integrated database retrieval system