KEGG   Enterobacter cloacae EcWSU1: EcWSU1_02520Help
Entry
EcWSU1_02520      CDS       T01652                                 

Gene name
trpC
Definition
Tryptophan biosynthesis protein trpCF
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:eec01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:eec00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2598173..2599531
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKAQQPLASFQNDVVPSSRRFYDALQGARTAFILECKKASPS
KGVIRDDFDPARIAGIYKHHASAISVLTDEKYFQGSFDFLPVVSGIAPQPILCKDFIIDP
YQIWLARFYQADACLLMLSVLDDEQYRQLAAVAHSLNMGVLTEVSNEEELERAIALKAKV
VGINNRDLRDLSIDLNRTRQLAPRLGSGVTVISESGINSYAQVRELSHFANGFLIGSAMM
EHDDLNAAVRRVLLGENKVCGLTREEDALAAYEAGAIYGGLIFVASSPRVVTEAQARQVM
TAAPLSYVGVFRNADIADVVAKAEALSLHAVQLHGNEDQAYIDALRSALAPQVQIWKAQS
VGDRLPERNLNHVDKYVLDNGQGGTGQRFDWSLLHGEVLDNVLLAGGLSPDNCVEAAKAG
CAGLDFNSGVESQPGIKDASKLASVFKTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccgttttagcgaaaatcgttgccgataaggccatctgggtggaagcacgtaaa
gcacagcagccgctggccagcttccagaatgacgttgtcccgagcagccgtcgtttctat
gatgctctgcagggcgcacgcaccgcgtttattcttgagtgcaaaaaagcgtccccgtcg
aaaggcgttatccgtgacgatttcgatccggcgcgaattgccggtatctacaaacatcat
gcgtcagccatctccgtgctgacggatgagaagtatttccagggcagcttcgatttcctg
cccgttgtcagcgggatcgcgccacaaccgatcctgtgcaaagactttattatcgacccg
tatcagatctggctggctcgcttttaccaggccgatgcctgcctgctgatgctctcagtg
ctggatgacgaacagtatcgccagctcgctgcggtcgcgcacagtctgaacatgggcgtg
ctgaccgaagtgagcaacgaagaggagctggaacgcgccattgcgctgaaagccaaagtg
gtcggcatcaacaaccgcgatctgcgtgacctgtcgattgacctgaaccgcacgcgccag
ctggcgccgcgtctgggctctggcgtcaccgtgatcagtgaatccggtattaacagctac
gctcaggtccgcgagctgagccatttcgccaacggtttcctgattggttctgcaatgatg
gaacatgacgatctcaacgccgcggtgcgccgcgtgctgttgggtgaaaacaaagtgtgc
ggcttaacccgtgaagaggatgccctggctgcgtatgaagccggtgcgatttacggcggg
ctgatttttgtcgcctcctccccgcgcgtggtgaccgaagctcaggcacgtcaggtgatg
acggcagcgccactcagctatgtgggggtctttcgcaacgcggatatcgccgacgtggta
gcaaaagccgaagcgttatctctgcatgcggtacagcttcatggcaacgaagatcaggcc
tatatcgatgccctgcgcagcgcgctggcacctcaggtgcaaatctggaaagcgcagagc
gtgggcgacaggttgcctgagcgtaacctgaatcatgttgataaatacgtactcgataat
ggccagggcggcacgggacagcgttttgactggtccctgttgcacggcgaagtgctggac
aatgttttgctggcgggtggacttagcccggataactgcgtggaagccgccaaagcgggc
tgcgcgggcctcgatttcaattcaggcgtagagtcgcaaccgggcatcaaagatgccagt
aagctggcctcggtatttaaaactctgcgtgcatattaa

DBGET integrated database retrieval system