KEGG   Enterobacter cloacae EcWSU1: EcWSU1_02521Help
Entry
EcWSU1_02521      CDS       T01652                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EcWSU1_02521 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EcWSU1_02521 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EcWSU1_02521 (trpB)
Enzymes [BR:eec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EcWSU1_02521 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2599485..2600735
Genome map
AA seq 416 aa AA seqDB search
MPVSWPRYLKLCVHIKEEKMTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPAF
QAEFTDLLKNYAGRPTALTKCRNLTEGTKTTLYLKREDLLHGGAHKTNQVLGQALLAKRM
GKTEIIAETGAGQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHS
GSATLKDACNEALRDWSGSYETAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILEKEG
RLPDAVIACVGGGSNAIGMFADFIDETSVGLIGVEPAGHGIETGEHGAPLKHGRVGIYFG
MKAPMMQTDDGQIEESYSISAGLDFPSVGPQHAFLNSTGRADYVSITDDEALEAFKTLCR
HEGIIPALESSHALAHALKMMKENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgccagtaagctggcctcggtatttaaaactctgcgtgcatattaaggaagagaagatg
acgacattactaaacccctattttggtgagttcggcgggatgtacgtcccgcaaatcctg
atgcccgccctgcgccagctggaagaagcgttcgtgagcgcgcagaaagatccggcgttt
caggctgagtttaccgacctgctgaaaaactacgctggccgtccaacggccctgacgaaa
tgccgtaacctgaccgaaggcaccaaaaccacgttgtatcttaagcgtgaagatttgctg
cacggcggtgcgcataaaaccaaccaggtgttgggtcaggcgctgcttgcaaaacggatg
ggtaaaaccgaaatcatcgctgaaactggcgcaggccagcacggggtggcatcagccctt
gccagcgcccttctcggtctgaaatgccgcatttacatgggcgcaaaagacgttgagcgc
cagtcacctaacgtattccgtatgcgtctgatgggcgctgaagtgatcccggtgcacagc
ggctccgcgacgctgaaggatgcgtgtaacgaagcgctgcgcgactggtctggcagctat
gaaaccgcgcactatatgctcggcaccgctgcaggcccgcacccgttcccgacgattgtg
cgtgaattccagcgcatgattggcgaagagaccaaagcgcagatcctggaaaaagagggt
cgcctgccggatgcggtgatcgcctgcgttggcggtggctctaacgctatcggcatgttc
gctgatttcatcgacgaaaccagcgtcgggctgattggcgttgaacctgcaggccacggg
attgaaaccggtgagcacggcgcaccgttgaaacatggtcgcgtcgggatctacttcggt
atgaaagcgccgatgatgcagaccgatgacggccagattgaagagtcatactctatctcg
gcaggcctagatttcccttccgttgggcctcagcatgccttcctgaacagtaccggtcgt
gcggactacgtttccattaccgatgacgaggccctggaggcgtttaaaacgctctgtcgc
cacgaagggatcattcctgctctggagtcctctcacgccctggcgcatgcgctgaaaatg
atgaaagagaacccggaaaaagagcaactgctggtggttaacctttccggtcgcggtgat
aaagacatcttcaccgttcacgatattttgaaagcacgaggggaaatctga

DBGET integrated database retrieval system