KEGG   Enterobacter cloacae EcWSU1: EcWSU1_02522Help
Entry
EcWSU1_02522      CDS       T01652                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00260  Glycine, serine and threonine metabolism
eec00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eec01100  Metabolic pathways
eec01110  Biosynthesis of secondary metabolites
eec01130  Biosynthesis of antibiotics
eec01230  Biosynthesis of amino acids
Module
eec_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EcWSU1_02522 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EcWSU1_02522 (trpA)
Enzymes [BR:eec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EcWSU1_02522 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Amidohydro_2 His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEW73957
UniProt: G8LDU5
Position
2600735..2601544
Genome map
AA seq 269 aa AA seqDB search
MERYDNAFAALKSRQEGAFVPFVTLGDPGPEQSLKIIDTLIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPGQCFEMLAAIRQKHPTIPIGLLMYANLVFSRGIDTFYAECAR
VGVDSVLVADVPVEESAPFRQAAMRHNVAPIFICPPNADDELLRQIASYGRGYTYLLSRA
GVTGAENKAALPLHHLVEKLAEYHAAPPLQGFGISSPDQVTAAIDANAAGAISGSAIVKI
IEKNVDKPEQMLAELKTFVSAMKAATRKA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgataacgcatttgcagcactgaaatctcgccaggaaggcgcgttcgtt
cccttcgtgacgctgggtgacccgggtcctgagcagtcgctgaaaattatcgacaccctg
attgaggccggtgccgacgcgctggaactgggtattccgttttccgatcctctggccgat
ggcccgactatccagaacgcaacgctgcgggcattcgcggccggtgtcaccccggggcaa
tgttttgagatgctggccgctatccgccagaagcacccgaccattccgattggcctgtta
atgtatgccaacctggtcttcagtcgcggtattgataccttttatgcagaatgcgcgcgc
gtgggcgttgactcggtgctggtggcagacgtaccggttgaagaatctgcgccgttccgc
caggcggcgatgcgccataacgtggcacctatcttcatctgcccgccaaacgccgatgat
gaactgctgcgccagattgcctcttatggtcgcgggtatacctacctgctctcccgtgcg
ggtgtaaccggcgcggagaacaaagcggcgctgcctctgcatcatctggtcgagaagctg
gctgaataccacgcggcccctccgctgcagggctttgggatttcatctcccgatcaggtc
acggcggcaattgacgctaacgcagccggtgcaatctcaggctccgctatcgttaaaatc
attgagaagaacgtggacaagccagagcaaatgctggctgagctgaaaacgtttgtgagc
gcaatgaaagcggcaacgcgtaaagcgtaa

DBGET integrated database retrieval system