KEGG   Enterobacter cloacae EcWSU1: EcWSU1_02588Help
Entry
EcWSU1_02588      CDS       T01652                                 

Gene name
adhE
Definition
aldehyde-alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EcWSU1_02588 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcWSU1_02588 (adhE)
   00620 Pyruvate metabolism
    EcWSU1_02588 (adhE)
   00650 Butanoate metabolism
    EcWSU1_02588 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    EcWSU1_02588 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    EcWSU1_02588 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EcWSU1_02588 (adhE)
   00626 Naphthalene degradation
    EcWSU1_02588 (adhE)
Enzymes [BR:eec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EcWSU1_02588 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EcWSU1_02588 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2656907..2659660
Genome map
AA seq 917 aa AA seqDB search
MALSILSDVSSAGLLKEFKHYQESIMAVTNIAELNALVERVKKAQREYANFTQEQVDKIF
RAAALAAADARIPLAKMAVAESGMGIVEDKVIKNHFASEYIYNAYKDEKTCGVLAEDHTF
GTITIAEPIGIICGIVPTTNPTSTAIFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQ
AAIAAGAPKDLIGWIDQPSVELSNALMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAG
NTPVVIDETADIKRAVASVLMSKTFDNGVICASEQSVVVVDSVYDAVRERFASHGGYMLQ
GKELKAVQDIILKNGALNAAIVGQPAYKIAELAGFTVPATTKILIGEVKVVDESEPFAHE
KLSPTLAMYRAKDFEDAVVKAEKLVAMGGIGHTSCLYTDQDNQPERVAHFGQMMKTARIL
INTPASQGGIGDLYNFKLAPSLTLGCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHK
LPKSIYFRRGSLPIALDEVITDGHKRALIVTDRFLFNNGYADQITSVLKAAGVETEVFFE
VEADPTLTVVRKGAELANSFKPDVIIALGGGSPMDAAKIMWVMYEHPETHFEELALRFMD
IRKRIYKFPKMGVKAKMIAVTTTSGTGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVD
ANLVMEMPKSLCAFGGLDAVTHALEAYVSVLASEFSDGQALQALKLLKENLPASYNEGSK
NPVARERVHSAATIAGIAFANAFLGVCHSMAHKLGSQFHIPHGLANALLISNVIRYNAND
NPTKQTAFSQYDRPQARRRYAEIADHLGLSAPGDRTAAKIEKLLAWLESLKAELGIPKSI
REAGVQEADFLAHVDKLSEDAFDDQCTGANPRYPLISELKQILLDTFYGREFKENDTVAV
KVDAPVIKADKKAKKNA
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
gtggctctgtctatactgtcagacgtatcgagcgctggtttactaaaagagtttaaacat
tatcaggagagcattatggctgttactaatatcgctgaactgaacgcactcgtcgagcgc
gtgaaaaaagcccagcgtgaatacgccaatttcacccaagaacaggttgataaaatcttc
cgcgcggccgctctggctgctgcagatgctcgaatccctctcgctaaaatggccgttgct
gaatccggcatgggtatcgttgaagataaagtgatcaaaaaccactttgcttcagagtat
atctataacgcctataaagatgagaagacttgcggcgtcctggctgaagatcataccttc
ggtaccatcaccattgctgaacctatcggtattatttgcggtatcgttccaacgactaac
ccaacgtctactgccatcttcaaatcgctgatcagtctgaagacccgtaacgcaatcatc
ttctcccctcacccacgtgctaaagatgccaccaacaaagcagcggatatcgtgctgcag
gctgctatcgctgcgggtgcgccaaaagatctgatcggctggatcgaccaaccgtctgtt
gaactgtctaacgccctgatgcaccacccggacattaacctgatcctggcaaccggtggt
cctggcatggttaaagcagcatacagctccggtaaaccggctatcggtgtaggtgcgggt
aacacgcctgttgttatcgacgaaacggccgatattaaacgtgctgttgcatctgtactg
atgtctaaaaccttcgacaacggtgttatctgtgcgtctgaacagtccgttgttgttgta
gattccgtctatgatgcggttcgcgaacgtttcgccagccacggcggctacatgctgcag
ggcaaagagctgaaagccgttcaggatatcattctgaaaaacggcgcgctgaacgccgcc
atcgttggtcagccagcctataaaatcgctgaactcgccggctttaccgttccggcaacc
accaagattctgatcggcgaagttaaagttgtcgacgaaagcgaaccgttcgctcacgaa
aaactctcgcctacgcttgctatgtaccgtgcgaaagatttcgaagacgcggtagtaaaa
gcggagaaactggttgcaatggggggtatcggtcatacctcttgcctgtacaccgaccag
gataaccagccagagcgcgttgctcacttcggtcagatgatgaaaactgcgcgcatcctg
attaacaccccggcttctcagggtggtatcggtgacctgtacaacttcaaactcgcacct
tccctgactctgggttgtggttcctggggtggtaactccatctctgaaaacgttggtcca
aaacacctgatcaacaagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaa
cttccgaaatctatctacttccgccgtggctctctgccaatcgcgctggatgaagtgatt
actgatggccacaaacgtgcgctcatcgtgactgaccgtttcctgttcaacaacggctac
gcagaccagatcacttctgttctgaaagcggctggcgttgaaactgaagtgttctttgaa
gttgaagctgacccaaccctgaccgtagtgcgtaaaggtgctgaactggcgaactccttc
aaacccgatgtgatcatcgcactgggtggtggttccccaatggacgccgcgaaaatcatg
tgggttatgtacgagcacccagaaacacacttcgaagaactggcgctgcgctttatggac
atccgtaaacgtatctacaagttcccgaaaatgggcgtaaaagcgaaaatgatcgccgtt
accaccacttccggtacaggttcagaagtcacgccatttgccgttgtaaccgacgatgca
accggtcagaaatacccactggctgactacgcgctgacgccagatatggctatcgttgat
gccaacctggtcatggaaatgccgaaatcactctgtgcgttcggtggtctggatgccgtg
actcacgccctggaagcttacgtttccgtactggcttctgagttctctgacggccaggct
ctgcaggctctgaaactgctgaaagaaaacctgccagcgtcttataatgaagggtctaaa
aacccggttgcccgtgaacgtgttcacagtgcagcaaccatcgccggtatcgcgtttgct
aacgccttcctgggtgtttgccactcaatggcacacaaactgggttcacagttccacatt
cctcacggtctggcgaacgccctgttgatcagcaacgttatccgttataacgcgaacgac
aacccaaccaagcagactgctttcagccagtacgaccgtccacaggcacgtcgtcgttac
gctgaaatcgcagaccacctgggtctgagtgcaccgggcgaccgtactgcggcgaagatt
gagaaactgctggcatggctggaaagccttaaagctgagctgggtattcctaaatctatc
cgtgaagcgggcgttcaggaagctgacttcctcgcgcatgttgataagctgtctgaagat
gcattcgatgaccagtgtaccggtgccaacccgcgctacccgctgatctctgagctgaaa
cagatcctgctggataccttctacggccgcgagttcaaagaaaatgacactgttgctgtg
aaagtagacgcacctgtcattaaagctgacaagaaagcgaagaaaaacgcgtaa

DBGET integrated database retrieval system