KEGG   Enterobacter cloacae EcWSU1: EcWSU1_02786Help
Entry
EcWSU1_02786      CDS       T01652                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:eec03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2885641..2886333)
Genome map
AA seq 230 aa AA seqDB search
MTNQAGCLSSLFLLCRQLISSRTQERHVIGRLRGIIIEKQPPLVLLEVGGVGYEVHMPMT
CFYELPDAGKEAIVFTQFVVREDAQLLYGFNNKQERMLFRELIKTNGVGPKLALAILSGM
SAPQFVNAVEREDPAALIKLPGIGKKTAERLIVEMKDRFKGLHGDLFTPAADLVLTSPGA
QASDDAEQEAVAALVALGYKPQEASRMVSKIAKPDASSETLIREALRAAL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaggctggatgtttatccagcctttttttattatgtcggcagttaatttct
tccagaacgcaggagcgtcacgtgataggcagactcagaggcatcatcattgaaaaacaa
cccccgttagtgctgctggaagtcggtggcgtgggctatgaagtccatatgccgatgact
tgcttctatgagttgccggatgcgggcaaagaggcgattgtctttacccagtttgtggtg
cgtgaagatgcccagttgctgtatggcttcaacaacaaacaggaacggatgctgtttcgc
gagctgatcaaaaccaacggcgtcgggccgaagctggcgctggctattttgtccggcatg
tccgctccgcagttcgtcaatgccgttgagcgcgaagatcctgctgcgttgattaaactc
ccgggtatcggcaagaaaaccgcggagcgtttgattgtcgagatgaaagaccgctttaaa
ggtctgcatggcgatctgtttacgccagccgctgatctggtgcttacctcgccgggcgca
caagcctctgatgatgcagaacaggaagcggttgctgcgctggtggcgctgggatataaa
cctcaggaggccagccggatggtgagcaagattgccaaaccggatgccagcagtgaaacc
ctgattcgtgaagcgctacgcgcggcattgtga

DBGET integrated database retrieval system