KEGG   Enterobacter cloacae EcWSU1: EcWSU1_02965Help
Entry
EcWSU1_02965      CDS       T01652                                 

Gene name
galF
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00040  Pentose and glucuronate interconversions
eec00052  Galactose metabolism
eec00500  Starch and sucrose metabolism
eec00520  Amino sugar and nucleotide sugar metabolism
eec01100  Metabolic pathways
eec01130  Biosynthesis of antibiotics
Module
eec_M00362  Nucleotide sugar biosynthesis, prokaryotes
eec_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EcWSU1_02965 (galF)
   00052 Galactose metabolism
    EcWSU1_02965 (galF)
   00500 Starch and sucrose metabolism
    EcWSU1_02965 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    EcWSU1_02965 (galF)
Enzymes [BR:eec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EcWSU1_02965 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 PvlArgDC
Motif
Other DBs
NCBI-ProteinID: AEW74393
UniProt: G8LIV2
Position
complement(3069284..3070192)
Genome map
AA seq 302 aa AA seqDB search
MEEIMINLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVT
HSSKNAVENHFDTSYELEALLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILC
ARPVVGDNPFIVVLPDIIIDSASADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSV
IQTKEAMETEGQVSRIVEFIEKPDQPQTLDSDLMAVGRYVLNADIWAELEKTEPGAWDRI
QLTDAIAELAKKQSVDAMLMTGDSYDCGKKLGYMQAFVKYGLRNLKEGQKFRSRIEKLLA
ND
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtggaagaaataatgattaatttgaaagcagtcattccggtagcaggcttgggcatgcat
atgctgccagccacaaaagccattcctaaagagatgctgccgattgtcgacaaaccgatg
attcaatacattgtcgatgaaattgttgctgcagggatcaaagaaatcgtcctggttacg
cactcctccaagaatgcggtagaaaaccacttcgacacctcttacgaactcgaagcgttg
cttgagcagcgcgtaaaacgccagctgctggctgaagtgcagtctatctgccctcctggc
gtaaccatcatgaacgtgcgtcaggcgcagccgctgggtctgggccactccattctttgc
gcgcgcccggtcgtgggtgacaacccgttcatcgttgttctgccggatatcattatcgac
agcgcatctgccgatccgctgcgttacaacctggcggcaatggtggcgcgcttcaacgaa
acgggccgcagccaggtgcttgctaagcgcatgaaaggcgatctctccgagtactctgtt
atccagactaaagaagcgatggaaacggaagggcaggtgagccgcatcgttgagtttatc
gagaaaccggatcagccgcagacgctggattctgacctgatggccgtcggccgttatgtt
ctcaacgcggatatctgggccgagctggaaaaaaccgaaccgggtgcctgggaccgtatc
cagttgaccgatgcgattgctgaactggctaagaagcagtctgttgatgcgatgctgatg
accggtgacagctacgactgcggtaagaaactgggctatatgcaggcatttgtgaagtat
ggcctgcgtaacctgaaggaaggtcagaagttcagaagccggattgagaagttgctggct
aacgactga

DBGET integrated database retrieval system