KEGG   Enterobacter cloacae EcWSU1: EcWSU1_02965Help
Entry
EcWSU1_02965      CDS       T01652                                 

Gene name
galF
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EcWSU1_02965 (galF)
   00052 Galactose metabolism
    EcWSU1_02965 (galF)
   00500 Starch and sucrose metabolism
    EcWSU1_02965 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    EcWSU1_02965 (galF)
Enzymes [BR:eec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EcWSU1_02965 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3069284..3070192)
Genome map
AA seq 302 aa AA seqDB search
MEEIMINLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVT
HSSKNAVENHFDTSYELEALLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILC
ARPVVGDNPFIVVLPDIIIDSASADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSV
IQTKEAMETEGQVSRIVEFIEKPDQPQTLDSDLMAVGRYVLNADIWAELEKTEPGAWDRI
QLTDAIAELAKKQSVDAMLMTGDSYDCGKKLGYMQAFVKYGLRNLKEGQKFRSRIEKLLA
ND
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtggaagaaataatgattaatttgaaagcagtcattccggtagcaggcttgggcatgcat
atgctgccagccacaaaagccattcctaaagagatgctgccgattgtcgacaaaccgatg
attcaatacattgtcgatgaaattgttgctgcagggatcaaagaaatcgtcctggttacg
cactcctccaagaatgcggtagaaaaccacttcgacacctcttacgaactcgaagcgttg
cttgagcagcgcgtaaaacgccagctgctggctgaagtgcagtctatctgccctcctggc
gtaaccatcatgaacgtgcgtcaggcgcagccgctgggtctgggccactccattctttgc
gcgcgcccggtcgtgggtgacaacccgttcatcgttgttctgccggatatcattatcgac
agcgcatctgccgatccgctgcgttacaacctggcggcaatggtggcgcgcttcaacgaa
acgggccgcagccaggtgcttgctaagcgcatgaaaggcgatctctccgagtactctgtt
atccagactaaagaagcgatggaaacggaagggcaggtgagccgcatcgttgagtttatc
gagaaaccggatcagccgcagacgctggattctgacctgatggccgtcggccgttatgtt
ctcaacgcggatatctgggccgagctggaaaaaaccgaaccgggtgcctgggaccgtatc
cagttgaccgatgcgattgctgaactggctaagaagcagtctgttgatgcgatgctgatg
accggtgacagctacgactgcggtaagaaactgggctatatgcaggcatttgtgaagtat
ggcctgcgtaacctgaaggaaggtcagaagttcagaagccggattgagaagttgctggct
aacgactga

DBGET integrated database retrieval system