KEGG   Enterobacter cloacae EcWSU1: EcWSU1_03067Help
Entry
EcWSU1_03067      CDS       T01652                                 

Gene name
folE
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EcWSU1_03067 (folE)
Enzymes [BR:eec01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     EcWSU1_03067 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3188009..3188755)
Genome map
AA seq 248 aa AA seqDB search
MRRLTHNERTLLPQRGQKTPHLQEKRMPSLSKEAALVHEALVARGLETPLRPPVQELDNE
TRKHLIAGHMTEIMQLLNLDLSDDSLMETPHRIAKMYVDEIFSGLDYANFPKITVIENKM
KVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDTVIGLSKINRIVQFFAQRPQVQER
LTQQILTALQTLLGTNNVAVSIDAVHYCVKARGVRDATSATTTTSLGGLFKSSQNTRQEF
LRAVRHHN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcctcacgcacaatgagcgcacacttttgccacaacgagggcaaaagacgcca
cacctgcaggagaaaagaatgccatcactcagtaaagaagcagccctggttcacgaagct
ctggttgcgcgtggtcttgaaacgccactgcgtccacccgttcaggaactggacaatgaa
acccgtaagcatctgattgctgggcatatgaccgagatcatgcaactgctgaatctcgat
ctgagcgacgacagtctgatggagacgccgcaccgtatcgcaaaaatgtacgttgacgaa
attttctccggcctggattacgccaatttcccgaaaatcaccgtcattgaaaacaagatg
aaggtggatgagatggtaacggtacgtgatatcacgttaaccagtacctgcgaacaccac
ttcgtgaccatcgacggtaaagcgaccgtggcttatattcctaaagatacggtgattggt
ctgtcgaagatcaaccgcatcgtgcagttctttgctcagcgtccacaggtgcaggagcgt
ctgacgcagcagatcctgaccgcgctgcaaacgctgctgggcaccaataacgtggcagta
tctatcgacgccgttcactactgtgtgaaagcgcgcggcgtgcgtgatgccaccagtgcg
accaccacgacgtcgctgggcggtctgtttaaatccagccagaacacccgccaggagttt
ctgcgcgccgtgcgtcaccacaactaa

DBGET integrated database retrieval system