KEGG   Enterobacter cloacae EcWSU1: EcWSU1_03213Help
Entry
EcWSU1_03213      CDS       T01652                                 

Gene name
fadJ
Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00071  Fatty acid degradation
eec00280  Valine, leucine and isoleucine degradation
eec00281  Geraniol degradation
eec00310  Lysine degradation
eec00362  Benzoate degradation
eec00380  Tryptophan metabolism
eec00410  beta-Alanine metabolism
eec00640  Propanoate metabolism
eec00650  Butanoate metabolism
eec00903  Limonene and pinene degradation
eec00930  Caprolactam degradation
eec01040  Biosynthesis of unsaturated fatty acids
eec01100  Metabolic pathways
eec01110  Biosynthesis of secondary metabolites
eec01120  Microbial metabolism in diverse environments
eec01130  Biosynthesis of antibiotics
eec01200  Carbon metabolism
eec01212  Fatty acid metabolism
Module
eec_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EcWSU1_03213 (fadJ)
   00650 Butanoate metabolism
    EcWSU1_03213 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    EcWSU1_03213 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    EcWSU1_03213 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EcWSU1_03213 (fadJ)
   00310 Lysine degradation
    EcWSU1_03213 (fadJ)
   00380 Tryptophan metabolism
    EcWSU1_03213 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EcWSU1_03213 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EcWSU1_03213 (fadJ)
   00281 Geraniol degradation
    EcWSU1_03213 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EcWSU1_03213 (fadJ)
   00930 Caprolactam degradation
    EcWSU1_03213 (fadJ)
Enzymes [BR:eec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EcWSU1_03213 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EcWSU1_03213 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EcWSU1_03213 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AEW74641
UniProt: G8LLK8
Position
complement(3342874..3345021)
Genome map
AA seq 715 aa AA seqDB search
MDMPSAFNLTVRLDNVAVITVDVPNEKMNTLKAEFGVQVRAMLKQIRENKAIRGLVFISA
KPDNFIAGADINMIARAQNAQEAEELARQGQQVMAEIHALSIPVIAAIHGACLGGGLELA
LACHSRICTDDAKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALEMILTGKQLRARQAL
KAGLVDEVVPHAILLEAAVELALKGRQAKRPLPVRERVLAGPLGRTLLFSMAGKKTEQKT
KGNYPAAKRILEVIEVGLSQGSSSGYAAEAKAFGELAMTPQSQALRNIFFASTEVKKDPG
SEAQPAPLHAIGVLGGGLMGGGISFVTASKGKLPVRIKDINAKGINHALQYSWQNLDQKV
KRRHIKANERDKTLALISGTTDYSGFAHRDLVIEAVFEDLALKQQMVADVEQHCAPHTIF
ASNTSSLPIGDIAARAQRPEQVIGLHYFSPVEKMPLVEVIPHASTSPQTVATVVKLAKMQ
GKTPIVVADKAGFYVNRILAPYINEAMRLLTEGEKIEHVDEALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEDAYGDRFSPPANIVSAILKDDRKGRKNERGFYLYGAKGRKSKKQVDPS
VYGLIPTTGQGKLSPVQCAERCVMMMLNEAARCFGEQVIKSARDGDIGAVFGIGFPPFLG
GPFRYMDTLGAGEVVAIMQRLASQYGPRFTPCDELLQMAERGQTFWPSRETVLVS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggatatgccatctgcatttaatctgacggtacgcctcgataacgtcgccgttattact
gtcgatgttcccaacgagaagatgaacaccctgaaagccgagttcggcgttcaggtgcgc
gcgatgctaaagcagatccgtgagaacaaagcgattcgcggcctggtgtttatctcggcg
aaaccggacaactttattgccggagccgatatcaacatgattgcccgggcgcaaaacgct
caggaagccgaagagctggcgcgtcaggggcaacaggtcatggcggagatccatgcgctg
tctatcccggtcatcgcggcgatccacggtgcctgtctgggcggtgggctggagctggcg
ttggcctgtcacagccgcatttgtaccgacgatgcgaaaaccgttctgggcctgcctgaa
gtgcagttaggcctcctgccaggctccggcgggacgcagcgtctgccgcgtctggttggg
gtcagcactgcgctggaaatgatattaaccggcaaacaactgcgtgcccgtcaggcgctg
aaagccggcctggtcgacgaggtggttcctcacgccattttgcttgaggcggcggttgaa
ctggcgctcaaaggacggcaggcaaaacgtcctctgccggtgcgtgagcgcgtgctggcc
gggccactgggccgcacactcctgttcagcatggcgggcaagaaaaccgaacaaaaaacc
aaaggtaactacccggcggcgaaacgtatccttgaggttattgaagtggggttatctcag
ggcagcagcagcggctatgccgcagaagcaaaagcctttggcgagctggcgatgacgccg
cagtctcaggcgctgcgtaacatcttttttgccagtacagaggtaaaaaaagaccccggc
agcgaggcgcagcctgccccgctgcatgccattggcgtactgggtggcgggctgatgggg
ggcggaatatcttttgttaccgccagcaaaggcaaattgcctgtacgtatcaaagacatc
aatgcgaaaggaatcaatcacgcgctgcagtacagctggcagaaccttgatcaaaaggtt
aaacgccgccatatcaaggccaatgagcgtgataaaaccctggcactgatctccggcacg
acagactacagcggttttgcccatcgcgatctggtgattgaagcggtgtttgaagacctg
gcgcttaagcagcagatggtggctgacgttgagcaacattgcgcaccccataccattttt
gcgtcgaacacctcgtcattgcccattggcgatattgcggccagagcccagcgtccggag
caggtgattggcctgcactatttcagtccggttgaaaaaatgccgctggtggaggttatc
ccgcacgccagcaccagcccgcaaaccgttgctaccgtggttaaactggccaaaatgcag
ggtaagacaccgatagtggtggcggacaaagccggcttttacgttaaccgcattctggcg
ccttatataaatgaagcgatgcggcttctgacggaaggggagaagatcgaacacgtcgac
gaggcgctggtgaagtttgggttccccgttggcccaatccaacttttggatgaggtggga
atcgacaccggcactaaaattatacctgtgctggaagatgcttatggagatcgttttagc
ccgcctgcaaacattgtttctgcaattttgaaggacgatcgcaaaggcagaaaaaatgaa
cgcggtttctatctttacggcgcgaaagggcgtaaaagcaagaaacaggtcgacccttcg
gtttatgggcttattccgacaaccggtcagggaaaactgtcacccgttcaatgtgctgaa
cggtgtgtgatgatgatgcttaatgaagcggcacgctgctttggtgagcaggtgattaaa
agcgcgcgcgatggtgacatcggtgcggtatttggcattggtttcccgccgttcctcggc
ggcccgttccgttacatggacactctcggtgcgggtgaagtggttgccatcatgcaacgt
ctggcctcgcaatacggtccgcggtttacaccgtgtgacgaattattgcagatggcggaa
cggggccagacattttggccttcaagggaaactgtcctcgtaagttga

DBGET integrated database retrieval system