KEGG   Enterobacter cloacae EcWSU1: EcWSU1_03226Help
Entry
EcWSU1_03226      CDS       T01652                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00010  Glycolysis / Gluconeogenesis
eec00052  Galactose metabolism
eec00500  Starch and sucrose metabolism
eec00520  Amino sugar and nucleotide sugar metabolism
eec00521  Streptomycin biosynthesis
eec01100  Metabolic pathways
eec01110  Biosynthesis of secondary metabolites
eec01120  Microbial metabolism in diverse environments
eec01130  Biosynthesis of antibiotics
eec01200  Carbon metabolism
Module
eec_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eec_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcWSU1_03226 (glk)
   00052 Galactose metabolism
    EcWSU1_03226 (glk)
   00500 Starch and sucrose metabolism
    EcWSU1_03226 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    EcWSU1_03226 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EcWSU1_03226 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    EcWSU1_03226 (glk)
Enzymes [BR:eec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EcWSU1_03226 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: AEW74654
UniProt: G8LLM1
Position
complement(3357834..3358799)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDVNSGEISRAKTYSGLDYPSLEAVVRVYLEEQQVSIEDGC
IAIACPITGDWVAMTNHVWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKPEHLIQFG
GTAPVEGKPIAVYGAGTGLGVSHLVHVDQRWVSLPGEGGHVDFAPNSEEEGIILEELRAE
IGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPKDVTERALADSCIDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLDFFTASGFRGAFEDKGRFRSYVQDIPVYLIV
HDNPGLLGSGAHLRQVLGQIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttggtaggcgatgtgggcggcacgaatgctcgccttgccctatgc
gatgtaaatagcggtgaaatttcccgggcgaaaacctattcagggctggattatccaagt
cttgaggccgttgttcgggtctatcttgaagagcaacaggtgagcatcgaagacggatgt
atcgccattgcctgcccgattaccggtgactgggtggcgatgaccaaccatgtctgggca
ttttccatcgctgagatgaaaaaaaaccttggtttttcgcatcttgaaatcatcaatgac
tttactgccgtgtccatggcgatcccgatgctgaagccagagcatctgattcagtttggc
ggtacagcgccagtagaaggtaagccgattgcggtctacggtgccggtaccggtcttggc
gtttcacatctggttcacgtcgaccagcgctgggtaagcctgccgggtgagggcggtcac
gtggactttgcgcccaacagcgaagaagagggcattatcctcgaagagctgcgcgctgaa
atcggccacgtctccgccgagcgcgtgctttccggtccgggtctggtgaatctgtaccgt
gcgattgtaaaatcagacggccgtctgccggagaatctgcagccaaaagatgtgaccgaa
cgcgcgctggcggacagctgcatcgactgtcgccgtgcgctgtcgctgttctgtgtgatc
atgggacggtttggcggcaacctggcgctgacgctgggcaccttcgggggagtttatatc
gcgggcgggatcgtaccgcgtttccttgacttctttacagcctcaggcttccgcggtgcg
tttgaagacaaaggtcgcttcagaagctatgtgcaggacatccctgtgtatctgattgtg
cacgataaccctggcctgcttggctcgggcgcgcacctgcgtcaggtactgggtcaaatc
ctctga

DBGET integrated database retrieval system