KEGG   Enterobacter cloacae EcWSU1: EcWSU1_03532Help
Entry
EcWSU1_03532      CDS       T01652                                 

Gene name
ascB
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eec00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3692051..3693475
Genome map
AA seq 474 aa AA seqDB search
MSVFPQGFLWGGALAANQSEGAYREGGKGLTTVDMIPHGANRLAVKVGKEKRFTLRDDEF
YPSHEAIDFYHRYKEDIALMAEMGFTVFRTSIAWSRLYPNGDEPLPNKEGIAFYRAVFEE
CKKYNIEPLVTLCHFDVPMHLVTEYGSWRNRKMVDFFARYARTCFEEFNGLVKYWLTFNE
INIMLHSPFSGAGLVFEEGENEDQVKYQAAHHELVASALATKIAHEVNPENQVGCMLAGG
NFYPYSCKPEDVWMALEKDRENLFFIDVQARGSYPAYSARVFREKGVVIVKDPADDELLK
NTVDFVSFSYYASRCASADMNASNTNAANIVKSLRNPHIQVSEWGWGIDPLGLRITMNMM
YDRYQKPLFLVENGLGAKDVMDEHGEINDDYRISYLREHIRAMGDAIEDGVPLMGYTTWG
CIDLVAASTGEMSKRYGFVYVDRDDAGNGTLDRTRKKSFWWYKKVIASNGADLA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtttttccacaaggatttttatggggcggcgcgcttgccgccaaccagagtgaa
ggggcttaccgtgaaggcggcaaaggactgacgacggtcgatatgatcccccacggcgcg
aatcgtctggcggtgaaggtcggtaaggaaaaacgttttacgttgcgtgacgacgagttt
tacccgagccacgaggcgattgatttttaccatcgctacaaagaagacatcgccctgatg
gcggagatgggctttacggtatttcgtacctcgattgcctggagccgcctctatccgaac
ggcgatgagccactgcccaataaagaggggattgccttctaccgcgcagtgttcgaagag
tgcaaaaaatacaacatcgaaccgttggtcaccctgtgccatttcgacgtaccgatgcat
ctggtcacggagtatggatcctggcgcaaccgcaagatggtcgatttcttcgcccgctat
gcccgtacctgtttcgaagaatttaacggtctggtgaagtactggctcaccttcaacgaa
atcaatatcatgctgcacagcccgttctccggcgcgggtctggtgtttgaagagggtgag
aacgaagatcaggtgaaatatcaggccgcgcatcacgaactggtggcaagcgccctggcg
accaaaatcgcccatgaggtgaacccggaaaaccaggtcggctgtatgctggccggcggc
aacttctacccctactcctgcaaaccggaagacgtgtggatggcgctggagaaagaccgc
gaaaacctgttctttatcgacgtgcaggcgcgcggcagctacccggcctattctgcccgc
gtgttccgcgaaaaaggggtggtgattgtcaaagaccctgccgacgatgaactgctgaaa
aacaccgtcgattttgtgtcgttcagctattacgcctcgcgctgcgcgtcggcggacatg
aacgccagtaataccaatgcggcgaatatcgtgaaatccctgcgcaacccgcacatccag
gtcagcgaatggggctggggtatcgacccactggggctgcgcatcaccatgaacatgatg
tacgaccgctatcagaagccgctgttcctggtggaaaacggcctcggtgcgaaagacgtt
atggatgaacacggtgagattaatgacgactaccgtatcagctacctgcgcgaacatatt
cgtgcgatgggcgatgccatagaagacggtgtgccgctgatgggctacaccacctggggc
tgcattgacctggtggccgcatccacgggcgagatgagcaaacgctacgggtttgtctat
gttgaccgcgacgacgcgggcaacggtacgctggacagaacgcgtaagaaatcgttctgg
tggtataagaaggtgattgcaagtaacggcgcggatctggcgtag

DBGET integrated database retrieval system