KEGG   Enterobacter cloacae EcWSU1: EcWSU1_03618Help
Entry
EcWSU1_03618      CDS       T01652                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eec00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EcWSU1_03618 (recD)
Enzymes [BR:eec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     EcWSU1_03618 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3775029..3776849)
Genome map
AA seq 606 aa AA seqDB search
MTMQELLLEAVEQRLLRHLDVQFAMMVSGDEPAVMLAAAILSKDAGEGHVCLPLSRLAMD
EKMPAALQSCFALLGESVDWPTVLHRSPAVSAADSQTPMILTGDRLYLNRLWRNELAVAR
FFSETNAPLPCDEAQLRQTLDTLFTSVEATDWQKVAAAVALTRRISVISGGPGTGKTTTV
AKLLAALIQLSGEQKCRIRLAAPTGKAAARLTESLGGALQKLPLTGEQLALFPNEASTLH
RLLGAQPGSQRLRYHAGNPLHLDVLVVDEASMIDLTMMARLIDALPAHARVIFLGDRDQL
ASVEAGAVLGDICTYASLGYTAERAEELSRLTGCSLASENHSLAGALRDSLCLLQKSYRF
GSDSGIGQLASAVNRGDRQMTCAVFDGQFTDIEKKSLQTGEEYQAMLDDALQGYQHFLTG
VQQQCTPAQALAAFGEYQLLCALREGPFGVSGLNDRFEQLLGQKRKIHRTPHSRWYEGRP
VMIARNDSTLGLFNGDIGIALDRGLGLRVWFQMPDGSVKSVQPSRLPEHETAWAMTVHKS
QGSEFNHAALILPTQLSPVITRELIYTAITRARQRLSLYADERVLLQAIATRTERRSGLS
AIFESL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgcaggaattgttgctggaagcggtagaacagcgactactgcgccacctggac
gtacagttcgccatgatggtgtcaggtgatgagcctgccgtgatgctcgccgctgccatc
ctgagtaaagacgcaggggaagggcacgtttgcctgccgctttcgcgtctggcgatggat
gagaaaatgcccgcggccctgcagtcctgctttgctctgctgggagaatccgtggactgg
ccgacggtgttgcaccgttcgcctgccgtcagcgcagccgatagccagacacccatgatc
ctgacgggcgatcgtttgtatctcaaccgactgtggcgtaatgaactggctgttgcgcgt
tttttcagcgagaccaatgcgcctcttccctgcgatgaagcccaactgcggcaaacgctg
gataccttgtttacctctgttgaggcgacagactggcagaaagtggcggcggctgtggcc
ttaacacggcggatatccgtcatctctggcggcccgggaaccggtaaaactaccactgtg
gccaaactgcttgccgccctgattcagttatcgggtgagcaaaagtgccgtattcgtctg
gcggcccctaccggcaaagcggcggcgcgcctgaccgagtcgttaggtggtgcgctgcag
aagttgccactcaccggggagcagcttgcccttttcccaaacgaagccagcacgctgcac
cggctgctgggcgctcagccgggaagccagcgtctgcgctatcacgccggtaacccgttg
cacctggatgtgctggtggtggatgaggcgtcgatgatcgacctgacgatgatggcgcgg
ttgattgatgctctgccagcgcacgcccgcgtcattttcctgggcgatcgcgaccagctt
gcctcggtggaagccggggcggtgctgggagatatctgcacttatgcaagcctgggatat
accgctgaacgcgctgaggagctgtcccgtctgaccggctgttcgctcgccagtgaaaac
cattcccttgcgggggcgctgcgcgacagcctgtgcctgctgcaaaaaagctaccgtttc
ggcagcgactcgggcatcggtcagctggcttcggctgtgaacagaggcgaccggcagatg
acctgtgcggtatttgacggtcaattcaccgatatcgagaaaaaatcgctgcaaaccggg
gaagagtatcaggcgatgcttgatgacgccctgcaggggtatcagcattttctgacaggt
gtacaacagcaatgcacgcccgcacaggcgctcgccgcctttggcgagtatcagctactg
tgcgcactgagggaagggccatttggcgtaagcggtctgaacgacaggttcgaacagctg
ctgggccagaaacgcaaaatccaccgcaccccgcactcgcgctggtatgagggacgcccg
gtgatgatcgcccgtaacgatagcacgctggggttgtttaacggggatatcgggattgcc
ctcgatcgtggactggggctgcgcgtctggttccagatgccggatggaagcgtgaagtcc
gttcagcccagccgcctgcctgaacatgaaacggcctgggcaatgacggtgcataagtct
cagggctccgagttcaaccatgcggcgctgatcctgccgacacagctttcgcccgtcatt
acccgcgaactgatttataccgccattacgcgcgcgcgtcagcgcctgtcgctgtatgcc
gatgaacgtgtgctgctacaggcgattgccacccgcacggaacgtcgaagcggcctgagc
gcgatatttgaatccctttaa

DBGET integrated database retrieval system