KEGG   Enterobacter cloacae EcWSU1: EcWSU1_03690Help
Entry
EcWSU1_03690      CDS       T01652                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
eec  Enterobacter cloacae EcWSU1
Brite
Enzymes [BR:eec01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     EcWSU1_03690 (dsbC)
Secretion system [BR:eec02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   EcWSU1_03690 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3854896..3855636)
Genome map
AA seq 246 aa AA seqDB search
MSADELGSYMKKSFALFTLLAASFTGFAHADDAAIKQSLAKLGVTSSDIQSAPVAGMKTV
LTNSGVLYVTEDGKHIIQGPMYDVSGAQPVNVTNQLLMKNLNALEKEMIVYKAAQEKHVI
TVFTDITCGYCHKLHEEMKDYNALGITVRYLAFPRAGVESKPEQDMKAIWCAKDRNKAFD
DAMNGKGVQPASCDIDIANHYALGVQFGVNGTPAIVLSNGYVVPGYQGPKEMKEFLDAHQ
KQFGGK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgccgacgaattaggatcttatatgaaaaagtctttcgcgctgttcaccctgctg
gcagcctcatttaccggttttgcccatgcggatgacgccgctatcaaacagtctctggcg
aagctaggcgtcaccagcagtgatatccagtctgcaccggttgccggcatgaaaacggtt
ctgacgaacagcggcgtgctgtacgtgaccgaagacggaaaacacattattcaggggcca
atgtacgacgtgagcggtgcacagccggtcaacgtaaccaaccagctgctgatgaaaaac
ctgaacgcgctcgaaaaagagatgatcgtttataaagcggcgcaggaaaaacacgtcatt
accgtcttcaccgacatcacctgtggctactgccataagctccatgaagagatgaaagat
tacaacgcgctggggatcaccgtgcgttatctggccttcccgcgcgcgggcgttgagagc
aagccagagcaggatatgaaagctatctggtgtgcgaaagaccgcaacaaagcctttgat
gacgcgatgaatggcaaaggcgtgcagcctgcatcctgcgacattgatatcgctaaccac
tacgcgctgggtgtgcagtttggcgtgaacggtacgccagcgattgtcctgagcaatggc
tatgttgttccgggttatcagggacctaaagagatgaaagagttcctcgacgcgcaccag
aaacagtttggtggtaaataa

DBGET integrated database retrieval system