KEGG   Enterobacter cloacae EcWSU1: EcWSU1_03978Help
Entry
EcWSU1_03978      CDS       T01652                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eec00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4138735..4139589)
Genome map
AA seq 284 aa AA seqDB search
MTMKLFAQDSHLDLSHPHVMGILNVTPDSFSDGGTHNTLIEAVKHANLMINAGATIIDVG
GESTRPGAADVSVEEELARVVPVVEAIAQRFEVWISVDTSKPEVIREVARVGAHIINDIR
SLTEPGALEAAAETGLPVCLMHMQGQPKTMQEAPKYDDVYADVNRFFIEHIARCERAGIA
KEKLLLDPGFGFGKNLSHNYELLARLSEFHHFDLPLLVGMSRKSMIGQLLNVGPSERLSG
SLACAVIAALQGAHIIRVHDVKETVEAMRVVEATLAAKENKRYE
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttgaccatgaaactattcgcccaggactcgcatctcgatctctcacatccgcatgtgatg
ggtatcctgaatgtcacgcctgactccttctctgacggcggcacgcataacacgcttatc
gaggctgtgaagcacgcaaatttgatgattaacgcgggcgccaccatcattgacgtaggc
ggggaatcgacgcgccctggggcggcagacgtttcggtggaagaagaactggcgcgcgtg
gtgcctgtggttgaagctatcgcacagcggttcgaagtgtggatctccgtcgatacgtct
aaacctgaagtgatccgtgaagtcgcgagagtgggtgctcacatcatcaatgatattcgc
tcgctgacggagcctggcgcactggaggcggccgcggagaccgggctaccggtttgcctg
atgcacatgcaaggacagccgaaaaccatgcaggaagcgccaaagtatgacgatgtttat
gccgacgtaaatcgcttctttattgagcatattgcacgttgtgaacgtgcgggtatcgca
aaagagaaattgctgctcgacccggggttcggtttcggtaaaaatctctctcacaattat
gagctgcttgcgcgcttatcggaattccatcatttcgacctgccattgctggttggtatg
tcgagaaagtcgatgattggtcagttactgaatgtagggccgagcgaacgtctgagcgga
agcctggcctgcgctgtaattgcggcgttgcagggtgcgcacattattcgtgtccatgac
gttaaagaaacagtagaagccatgcgtgtagtggaagctacactggcagcgaaggaaaac
aaacgctatgagtaa

DBGET integrated database retrieval system