KEGG   Enterobacter cloacae EcWSU1: EcWSU1_04019Help
Entry
EcWSU1_04019      CDS       T01652                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:eec00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:eec00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:eec03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:eec03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:eec03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4172508..4173014
Genome map
AA seq 168 aa AA seqDB search
MPFVGRVSPALHLNPQQEAPYMKNATFYLLDNDTHQDGLSAVEQLVCEIAAERWRAGKRV
LIACEDEQQAIRLDEALWARPPESFVPHNLSGEGPRGGAPVEIAWPQKRNSSARDILISL
RIDFADFATAFTEVVDFVPYEESLKQLARERYKAYRLAGFNLNTATWK
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttgtaggccgggtcagcccggccttgcatttaaatccacaacaagaagcccca
tatatgaagaatgcaacgttctaccttctggacaacgacacccatcaggacggcctcagc
gcagttgaacagctggtgtgtgaaattgccgcagaacgttggcgcgcaggtaaacgcgtt
ctgattgcctgcgaagatgagcagcaggccatccgccttgacgaagcactctgggcacgc
ccgccggagagttttgttccgcataatctgtctggcgaaggccctcgtggcggcgcaccg
gtagagattgcctggccgcaaaagcgcaacagcagcgcgcgcgatattctgattagcctg
cggatagattttgcagattttgccaccgctttcacagaagtggtagactttgtcccttac
gaagaatctttgaaacaactggcgcgcgaacgctataaagcgtaccgcctggctggtttt
aacctgaatacggcaacctggaaataa

DBGET integrated database retrieval system