KEGG   Enterobacter cloacae EcWSU1: EcWSU1_04328Help
Entry
EcWSU1_04328      CDS       T01652                                 

Gene name
bcsZ
Definition
(GenBank) Endoglucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
eec  Enterobacter cloacae EcWSU1
Brite
Enzymes [BR:eec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     EcWSU1_04328 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4485408..4486403)
Genome map
AA seq 331 aa AA seqDB search
MRKPACAALAVMMSLLFSPLSQAGQAWESYKARFFTPEGRIVDIGNGNVSHTEGQGFAML
MAVANDDKATFDKLWKWTDGTLKNKENGLFYWRYNPAESNPIADKNNAADGDVLIAWALL
KADTRWHDKQYSAASDAITKALISHTVTRYAGYRVMLPGVQGFTLDGEIVLNPSYFVFPA
WQAFASRSHSPVWGKLIQDGHRLLAKMGSGKARLPTDWVSLGSTGTLSPAKAWPPRMSYD
AIRIPLYLAWSDKKSPLLTPWRAWFGQFPREQTPAWVNVTTNEYAPYMMEGGLLAVRDLT
MGQPSGEPEITAKDDYYSASLKMLVWLAEQP
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaacccgcatgcgccgctctggccgtcatgatgagtttactgttctcccccctt
tctcaggcgggccaggcctgggagagttacaaagcacgcttctttacgccggaagggcgg
attgtcgatatcggcaacggcaatgtttcgcatactgaaggccagggcttcgccatgctg
atggcggtggctaacgacgataaagccacgtttgataagctgtggaaatggactgacggt
acgctaaagaacaaagaaaatggtctattttactggcgttataaccctgccgagtccaac
ccgattgccgacaaaaataacgccgccgatggcgatgtcctgattgcctgggcgctgttg
aaagcggatacgcgctggcatgacaaacagtacagcgccgcatcggatgcgataacgaaa
gcactcattagccacaccgtgacccgttatgcgggttaccgcgtgatgctgcccggtgtc
caggggtttaccctcgacggtgagatcgtgctaaacccctcttatttcgtcttcccggcc
tggcaggcctttgccagccgcagccattcgccggtctggggcaagttgattcaggatggc
catcgcttgctggcaaaaatgggatcgggtaaagccagacttcccacggactgggtctca
ctgggctctacgggcacgctgtccccggccaaagcctggccgccacggatgagctacgac
gcgatccgcattccactttacctggcctggtctgataagaagagcccgctgttaacgccg
tggcgagcctggttcggtcagttcccccgcgaacaaactcccgcatgggtaaacgtgacg
accaatgaatatgcgccttacatgatggaaggggggctgctggcggtacgtgatttaacg
atgggacagccatccggagaacccgagatcactgcaaaggatgattactactccgcaagc
ctgaaaatgcttgtatggcttgctgagcagccataa

DBGET integrated database retrieval system