KEGG   Enterobacter cloacae EcWSU1: EcWSU1_04336Help
Entry
EcWSU1_04336      CDS       T01652                                 

Gene name
fadB
Definition
Fatty acid oxidation complex subunit alpha
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EcWSU1_04336 (fadB)
   01212 Fatty acid metabolism
    EcWSU1_04336 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EcWSU1_04336 (fadB)
   00650 Butanoate metabolism
    EcWSU1_04336 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    EcWSU1_04336 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    EcWSU1_04336 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EcWSU1_04336 (fadB)
   00310 Lysine degradation
    EcWSU1_04336 (fadB)
   00380 Tryptophan metabolism
    EcWSU1_04336 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EcWSU1_04336 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EcWSU1_04336 (fadB)
   00281 Geraniol degradation
    EcWSU1_04336 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    EcWSU1_04336 (fadB)
Enzymes [BR:eec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EcWSU1_04336 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EcWSU1_04336 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EcWSU1_04336 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     EcWSU1_04336 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4498101..4500326
Genome map
AA seq 741 aa AA seqDB search
MTRSTCWIQETDMLYKGDTLYLNWLEDGIAELVFDAPGSVNKLDTATVASLGQALDVLEK
QSELKGLLLRSNKAAFIVGADITEFLSLFQVPEEQLSQWLHFANSVFNRLEDLPVPTVSA
VNGYALGGGCECLLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIA
AGKDVGAEQAQKIGLVDGVVKPEKLIEGSLAILHQAINGDLDWKAKRQPKLEPLKLSKIE
AAMSFTIAKGMVMQTAGKHYPAPITAVKTIEAAARFGRDEALKLENQSFVPLAHTNEARA
LVGIFLNDQFVKGKAKQLTKNVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDISEKS
LTLGMTEAAKLLNKQLERGKIDGLKLSGVISTIHPTLDYSGFDRVDVVVEAVVENPKVKK
AVLAETEEKVRPDTVLASNTSTIPISELAGVLKRPENFCGMHFFNPVHRMPLVEVIRGEK
TSDETIAKVVAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVME
KQFGWPMGPAYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDASRFGQKNGLG
FWRYKEDSKGKPKKEEDAAVDGLLADVSQPKRDFTDDEIIARMMIPMINEVVRCLEEGII
ASPAEADMALVYGLGFPPFHGGAFRWLDTLGSARYLDMAQQYQHLGPLYDVPEGLRNKAR
HNEPYYPAVEPARPVGELKTA
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaccagatccacttgctggattcaggagactgacatgctctacaaaggcgacaccctg
tacctcaactggctggaagatggcattgccgaactggtgttcgatgcccccggctcagtc
aacaagcttgataccgcgacggtggccagtcttggccaggcgctggatgtgcttgaaaaa
caatctgaattaaaaggactgctgctgcgctcaaacaaagcggcttttattgtcggtgca
gatatcaccgaattcctttcactgttccaggtcccggaagaacagctgagccagtggctg
cactttgccaacagcgtctttaatcgtctggaagatctgcctgttccgacagtctccgcc
gttaacggctacgcgctgggcggcggctgcgagtgcttgctggcaaccgactatcgtctg
gccacgccagacctacgcatcggcctgccggaaacaaaactgggcatcatgccaggcttt
ggcggttccgtacgtatgccacgcatgttgggtgccgatagcgccctggagatcatcgcc
gccggtaaagatgtcggggcggaacaggcgcagaaaataggcctggtggacggtgtggtt
aaaccagaaaaactgattgaaggctccctcgccattctccatcaggccattaatggcgac
ctcgactggaaagccaaacgtcagccgaagctggaaccgttgaaactcagcaaaattgaa
gccgccatgagcttcaccatcgccaaagggatggtgatgcagacggcaggcaaacactac
cccgcgcccattaccgccgttaaaacgattgaagccgcggcccgctttggccgtgatgaa
gcgctgaaactggaaaaccaaagctttgttccgctggcgcacactaatgaagctcgcgca
ctggtgggcatcttcctgaacgatcaattcgtgaaaggtaaggcgaaacagctgaccaaa
aatgttgagacgccaaaacaggcggcggtactcggtgcaggcattatgggcggcggtatc
gcttatcagtcggcctggaaaggcgtgcctgtggtgatgaaagacatcagcgagaaatcc
ctgacgctgggcatgaccgaagcggccaagctgctgaataaacagctggaacgcggcaaa
attgacggtctgaaactctcaggggtgatctcgacaatccacccgaccctggactatagc
ggtttcgaccgtgtggatgtggtcgttgaagcggtcgttgagaacccgaaagtcaaaaaa
gcggtgctggcggaaaccgaagagaaggttcgtcctgataccgtactggcctcaaacacc
tccaccatcccgattagcgaactggcaggcgttctgaagcgcccggaaaacttctgcggt
atgcacttctttaacccggtgcaccgtatgccgcttgtcgaagtgatccgtggggaaaaa
acttctgacgaaacgatcgccaaagtcgtggcatgggccagcaaaatgggcaaaacccca
atcgtggtcaacgactgtccgggcttcttcgtcaaccgcgtgctgttcccgtacttcgcc
ggtttcagccaactcctgcgcgacggtgcggatttccgcaaagtcgacaaagtgatggaa
aaacagttcggctggccgatgggtccggcgtatctgctggatgtggtcggcattgacacc
gcacaccacgcccaggcggtgatggcggcaggcttcccgcagcgcatgcagaaagattac
cgcgacgcgattgacgccctgtttgacgccagccgctttggtcagaaaaacggcctgggc
ttctggcgctataaagaagacagcaaaggcaagccgaagaaagaagaagacgcggcggtg
gatggcctgctggccgacgtcagccagccgaaacgtgacttcaccgacgatgaaatcatc
gcccgaatgatgattccaatgatcaacgaagtggtgcgttgcctggaagaaggcattatc
gccagcccggcagaagccgatatggcactggtgtacggcctcggcttccctccgttccac
ggcggcgcgttccgctggctggatacgctcggcagcgcccgttatctcgatatggctcag
cagtaccagcacctcggtccgctgtatgacgtgccggaaggtctgcgtaacaaagcgcgc
cataacgaaccctattacccagcagttgagccagcccgtccggttggcgagctgaaaacg
gcttaa

DBGET integrated database retrieval system