KEGG   Enterobacter cloacae EcWSU1: EcWSU1_04372Help
Entry
EcWSU1_04372      CDS       T01652                                 

Gene name
hemD
Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00860  Porphyrin and chlorophyll metabolism
eec01100  Metabolic pathways
eec01110  Biosynthesis of secondary metabolites
eec01120  Microbial metabolism in diverse environments
Module
eec_M00121  Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EcWSU1_04372 (hemD)
Enzymes [BR:eec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     EcWSU1_04372 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: AEW75800
UniProt: G8LKV8
Position
4536699..4537439
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPSPAGEQLVSRLRALGQVAWSFPLIEFSPGRELSALADHMNTLQQGDLLFALS
QHAVEFAQAQLQQQGLNWPTAPHYFAIGRTTALALHTVSGTDVRYPLDREISEVLLQLPE
LQTIAGKRALILRGNGGRELLGETLRERGAEVTFCECYQRCAKHYDGAEEAMRWHMRGIT
TLVVTSGEMLQQLWSLVPLWYRENWLLHCRLLVVSERLANQARELGWQDIRIADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtattcttgtcacccgcccttctcccgcaggagagcagttagtgagccgtctgcgc
gcactggggcaggtggcctggagttttccgctcattgaattctcccccggtcgggagctg
tccgcgcttgccgaccatatgaataccctccagcagggcgacttgctgtttgcgctgtcg
caacatgcggtggaatttgcccaggcgcagctgcaacagcaggggcttaactggccaacc
gcccctcactattttgcgattggtcgtacaacggcactggcgttgcataccgtaagcgga
acagacgttcgttacccgttagatcgggaaatcagcgaagtcttgctacaattacctgaa
ttacaaactattgccggaaagcgtgcactcattttacgcggtaacggcgggcgcgaactg
ttgggcgaaacgctgcgggaacgcggggctgaggtcacgttctgcgaatgctatcagcgt
tgtgcaaaacattacgatggtgcggaagaggcgatgcgctggcatatgcgcggtattacg
accctggtggtgaccagcggcgaaatgctgcagcagctctggtcgctggtgcccctttgg
tatcgtgaaaactggttactccactgccggcttctggtcgtcagtgagcgtctggcgaac
caggcccgggaactgggctggcaagatattcggatcgctgataatgctgacaacgatgcg
ctgctgcgcgcattacaataa

DBGET integrated database retrieval system