KEGG   Enterobacter cloacae EcWSU1: EcWSU1_04437Help
Entry
EcWSU1_04437      CDS       T01652                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    EcWSU1_04437 (glpK)
Enzymes [BR:eec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     EcWSU1_04437 (glpK)
Exosome [BR:eec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EcWSU1_04437 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4616224..4617732
Genome map
AA seq 502 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPRPGWVEHDPMEIWASQSST
LVEVLAKADISSDEIAAIGITNQRETTIVWERETGKPIYNAIVWQCRRTSEICEQLKRDG
MEDYVRSATGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNINTLEWDDKMLDALDIPRAMLPEVRKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPRGEVN
YALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTER
NYRYSGWKKAVKRALAWEEHEQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaaaaaatatatcgttgcgctcgaccagggcactaccagctcccgcgctgtc
gtaatggatcatgacgcgaatatcgtcagcgtgtcacagcgcgaatttgagcaaatctat
cctcgtccaggctgggtcgaacacgaccctatggagatctgggcttcacaaagctccacg
ctggtagaagtgctggcgaaagccgatatcagttccgacgagattgccgctatcggtatt
accaaccagcgtgaaaccactatcgtctgggagcgcgaaaccggtaagcccatttacaat
gccatcgtctggcagtgccgccgtacgtcagaaatctgcgaacagctgaagcgcgacggt
atggaagactatgtacgtagcgcaaccggtctggtcgttgacccgtatttctccggtaca
aaagtgaaatggatcctcgaccacgttgagggttcacgtgaacgtgcaaaacgcggtgag
ctgctgttcggtaccgtcgacacctggcttatctggaagatgacccaggggcgtgtccac
gtcactgattacaccaacgcctcgcgcaccatgctgttcaacatcaataccctggagtgg
gatgacaagatgctggacgcgctggatatcccgcgcgcgatgttgccagaagtccgcaag
tcttctgaggtttacggtcagaccaatatcggcggcaaaggcggcacgcgtattccaatt
gccggtattgccggtgaccagcaggcggcgctgtttggccagctgtgcgttaaggaaggg
atggcgaaaaacacctacggtaccggctgctttatgctgatgaacaccggtgagaaagcg
gtgaaatcagaaaacggcttgctgaccaccatcgcctgcggcccacgcggtgaagtgaac
tatgcgctggaaggtgcggtgttcatggcaggtgcgtctattcagtggctgcgtgacgag
atgaaactcatcagcgatgcgtttgactccgagtatttcgcaaccaaagtgaaggacacc
aacggtgtgtatgtggttccggcctttaccggtctgggcgcaccctactgggacccgtat
gcacgcggcgcgattttcggcctgacccgtggggtaaactcgaaccacattatccgcgct
acgctggaatccatcgcttatcagacgcgcgacgtactggaagcgatgcaggctgactcc
ggcatccgtctgcacgccctgcgcgtggacggcggcgccgttgccaacaacttcctgatg
cagttccagtccgacattctgggcacccgcgtagagcgcccggaagttcgtgaagtcacc
gcgctgggtgcggcgtatcttgcaggtctggctgtcggcttctggcagaatctggatgaa
ctgcaggaaaaagcggttatcgaacgcgaattccgccctggcatcgaaaccactgagcgt
aactaccgctacagcggctggaagaaagcggtgaaacgcgccctggcgtgggaagagcac
gagcagtaa

DBGET integrated database retrieval system