KEGG   Enterobacter cloacae EcWSU1: EcWSU1_04442Help
Entry
EcWSU1_04442      CDS       T01652                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EcWSU1_04442 (tpiA)
   01230 Biosynthesis of amino acids
    EcWSU1_04442 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcWSU1_04442 (tpiA)
   00051 Fructose and mannose metabolism
    EcWSU1_04442 (tpiA)
   00562 Inositol phosphate metabolism
    EcWSU1_04442 (tpiA)
Enzymes [BR:eec01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EcWSU1_04442 (tpiA)
Exosome [BR:eec04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EcWSU1_04442 (tpiA)
  Exosomal proteins of bladder cancer cells
   EcWSU1_04442 (tpiA)
  Exosomal proteins of melanoma cells
   EcWSU1_04442 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4620929..4621696
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRKELAGVTGCAVAIAPPDMYLDLAKHAADGSHII
LGAQNVDVNLSGAFTGETSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAKKFAVLKEQG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKVAEQVIIQYGGSVNASNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggttgcgaacctgcgtaaagagctggcgggcgtgacgggctgcgcggttgctatc
gctccgccggatatgtacctggatctggctaaacatgccgctgatggcagccacatcatt
ctgggcgcacagaacgttgacgttaacctgtcaggcgcattcaccggtgaaacctctgct
gaaatgctgaaagatatcggcgcgaaatacatcatcatcggccactctgagcgtcgcact
taccacaaagaatccgacgaatttatcgcgaagaaattcgcggtgctgaaagagcagggt
ctgatcccggttctgtgcatcggtgaaaccgaagccgaaaacgaagcaggcaaaacggaa
gaagtgtgtgctcgtcagatcgacgccgtgctgaaaacgcagggtgctgccgcattcgaa
ggcgcggttatcgcgtacgaacccgtctgggcgatcggtaccggcaaatcagcgacccct
gcgcaggcacaggcggttcacaaatttatccgtgaccacattgctaaagcggacgcgaaa
gtggctgagcaggtaattattcagtacggcggttcagttaacgcatccaacgctgctgag
ctgttcacccagccagacatcgatggcgcgctggttggcggtgcatccctgaaagctgac
gctttcgcggtgatcgttaaagcagcagaagcggctaaacaggcgtaa

DBGET integrated database retrieval system