KEGG   Enterobacter cloacae EcWSU1: EcWSU1_04446Help
Entry
EcWSU1_04446      CDS       T01652                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EcWSU1_04446 (pfkA)
   01230 Biosynthesis of amino acids
    EcWSU1_04446 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcWSU1_04446 (pfkA)
   00030 Pentose phosphate pathway
    EcWSU1_04446 (pfkA)
   00051 Fructose and mannose metabolism
    EcWSU1_04446 (pfkA)
   00052 Galactose metabolism
    EcWSU1_04446 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    EcWSU1_04446 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    EcWSU1_04446 (pfkA)
Enzymes [BR:eec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EcWSU1_04446 (pfkA)
Protein phosphatases and associated proteins [BR:eec01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EcWSU1_04446 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4625160..4626122)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVFGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDEHVREVAIENMKKRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGYFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFVVVPEVEFSREDLVAEIKAGIAKGKKHAIVAITEHICDVDELAKYIETETK
RETRATVLGHIQRGGSPGPYDRILASRMGAYAIELLLQGHGGRCVGIQNEKLVHHDIIDA
IENMKRPFKGDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccgggcatgaacgcggca
attcgtggggttgtccgttcagcgctgacggaaggcctggaagtttttggtatctatgat
ggttatctgggcctgtatgaagatcgtatggttcagctcgaccgttacagcgtgtccgac
atgatcaaccgtggcggtaccttcctcggttctgcgcgcttcccggaattccgtgatgaa
cacgtccgtgaagtggctattgagaacatgaaaaaacgtggccttgacgcactggttgtt
attggtggtgacggctcgtacatgggtgcaaaacgtctgactgaaatgggcttcccgtgc
atcgggctgccgggtacgatcgacaacgacatcaaaggcactgactacaccatcggctat
ttcaccgcactgggcaccgttgttgaagcgattgaccgcctgcgcgacacctcttcttcc
caccagcgtatctccatcgtggaagtgatgggccgttactgtggtgacctgacgctggct
gcggccatcgccggcggttgtgagttcgtggtggttccggaagtggaattcagccgtgaa
gatctggtggctgaaatcaaagcgggtatcgcaaaaggcaagaaacacgccatcgtagcc
atcaccgagcatatctgtgacgttgacgagctggcgaagtacatcgaaaccgaaaccaaa
cgtgaaacgcgtgctaccgttctgggccacatccagcgtgggggttccccgggtccatac
gaccgcatcctggcatcacgtatgggtgcatacgccattgaactgctgctgcagggtcat
ggcggtcgttgcgtgggtattcagaacgaaaaactggttcaccatgacatcatcgacgcc
attgaaaacatgaagcgtccgttcaagggtgactggctggactgcgcaaaaaaactgtac
tga

DBGET integrated database retrieval system