KEGG   Eubacterium eligens: EUBELI_00060Help
Entry
EUBELI_00060      CDS       T00908                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eel  Eubacterium eligens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:eel01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:eel01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eel00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:eel00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:eel00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eel00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:eel00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
62956..64191
Genome map
AA seq 411 aa AA seqDB search
MSMLKNILVGQSGGPTSVINSSLYGVIEEGLRNKEKIGTVYGMVHGIEGFLAGNFINLSE
VADNEPIDRLKITPASFLGSCRYMLPEDLGDNVYDKLFDTFAQMNIGYVFYIGGNDSMDT
VSKLSRVALLKKSDIRFIGVPKTIDNDLVMTDHTPGYGSTAKYVASTLKEIILDATCYAH
PSVTIVELMGRHAGWVTAASVLARTEYSRNPYLIYMPEHAFDMEEFKKSLKAALEQETAV
VVCVSEGIADKDGRFICEYADAASVDGFGHKMLTGCGKYLENYVKAEFGIKCRSIELNLP
QRCSSLLASATDIDEAEKAGKAAVVAALDGETGKMITFVRDDTNGYEINYGLADVNDICN
KEKKFPAEWITADGTDISDEYIKYVRPLIQGTNIAEYSDGVPVHLKPAYYR
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgttaaagaatattctggtaggtcagtcaggcggaccgacatcggttattaat
tcatcattatatggagtgattgaggaaggacttagaaataaggaaaagattggcactgtg
tatggcatggtgcatggaattgagggatttctggcaggcaatttcattaatctttctgaa
gtggcagataatgagccaattgatagattaaagataacaccggcttcttttcttggaagt
tgcaggtatatgcttccagaagatttaggggataatgtgtatgataaattgtttgataca
tttgcacagatgaacattggatatgtgttctatattggtggcaatgattcaatggataca
gtgtcaaaattatcaagagtggcattattgaagaaatcggacataagatttataggtgta
cctaagacaattgataatgatcttgtaatgacagatcatactccagggtatggttcaact
gcaaaatatgttgcttcaacattaaaagaaattatacttgacgcaacatgttatgcacat
ccgtctgtgacaattgttgaacttatgggaaggcatgcaggctgggttacagcggcatca
gtacttgctagaacagagtatagcagaaatccttatcttatatatatgccagagcatgca
tttgatatggaagaattcaagaagtcacttaaggcggcacttgaacaggaaactgcagtt
gttgtgtgcgtatcagaaggaattgcggacaaagacggcagattcatatgtgaatatgca
gatgcagcatcggttgatggttttggacataagatgcttacaggctgtggaaagtatctt
gaaaattatgttaaagcagaatttggaatcaaatgcagaagtattgagcttaatcttcca
cagagatgttcatcacttcttgcttcagcaacagatattgatgaagccgaaaaagcagga
aaggcagcggttgtagcagctcttgacggtgaaactggaaaaatgattacgtttgtaaga
gatgatactaacggatatgagattaattacggacttgcagatgtgaacgatatatgcaat
aaggaaaagaagttcccagcagaatggataaccgcagatggaacagatatttctgatgag
tatattaagtatgtaagaccacttattcagggaactaatattgcggagtattcagatggg
gtgccggttcatctgaagcctgcttattacagataa

DBGET integrated database retrieval system