KEGG   Eubacterium eligens: EUBELI_00064Help
Entry
EUBELI_00064      CDS       T00908                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
eel  Eubacterium eligens
Pathway
eel00010  Glycolysis / Gluconeogenesis
eel00030  Pentose phosphate pathway
eel00051  Fructose and mannose metabolism
eel00052  Galactose metabolism
eel00680  Methane metabolism
eel01100  Metabolic pathways
eel01110  Biosynthesis of secondary metabolites
eel01120  Microbial metabolism in diverse environments
eel01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUBELI_00064
   00030 Pentose phosphate pathway
    EUBELI_00064
   00051 Fructose and mannose metabolism
    EUBELI_00064
   00052 Galactose metabolism
    EUBELI_00064
  Energy metabolism
   00680 Methane metabolism
    EUBELI_00064
Enzymes [BR:eel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EUBELI_00064
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     EUBELI_00064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACR71101
UniProt: C4Z1C7
Position
complement(68499..69722)
Genome map
AA seq 407 aa AA seqDB search
MDGNVIVGQSGGPTSVINSSLAGVYKTAIDRGAKKVYGMLHGIKGLLDGQYVDLSEKINS
TMDIDLLKRTPSSYLGSCRYKLPEISEDRETFDKIFKILDDLDIKYFFYIGGNDSMDTIK
KLSDYAIVTGSDIKFMGVPKTIDNDLAVTDHTPGFGSAAKFIAATMKEIIRDGLVYDYPT
VTIVEIMGRNAGWLTAAAALAKSDDCEGVDLIYLPEKVFDIDHFMARVKEIAAKGRSMVI
AVSEGIKVADGRYVFELSEHVEFVDAFGHKQLAGSAKFLANKIGAELGIKTRAIELSTLQ
RCAAHMTSRTDITEAYNVGGAAVKAAFEGETGKVVVLKRVSDDPYMCITETNDVHQIANI
EKKVPLEWITDDDFVTDDLIHYIRPLIQAELSPIMVDGLPRHLNINA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggatggtaatgttatagttggacagtcaggaggacctacttctgttatcaactcaagt
cttgctggggtatataagacagccatagacagaggagctaagaaagtttatggtatgctc
cacggtattaagggacttcttgatggtcagtatgttgacctttcagagaagattaactca
acaatggatattgatttattaaagagaacaccttcatcttatcttggttcatgcaggtac
aagcttcctgagataagcgaagacagagaaacatttgataagattttcaagattcttgat
gatcttgatatcaaatatttcttctatattggtggtaacgactcaatggatactatcaag
aagttatctgattacgcaatcgtaaccggaagcgatattaaattcatgggtgtacctaag
actattgataatgacttagctgttacagaccacacaccaggatttggttctgctgccaag
tttatcgcagctactatgaaggaaatcatcagagatggtcttgtatatgattatcctaca
gttactattgtagagattatgggacgtaatgccggatggcttacagccgctgctgctctt
gcaaagagtgatgactgcgaaggtgtagaccttatctaccttccagagaaagtatttgat
atcgaccatttcatggcaagagttaaagaaattgcagctaagggccgttcaatggttatc
gctgtttcagaaggtattaaggttgctgacggaagatatgtattcgagctttcagagcat
gtagaattcgtagatgcatttggtcacaagcagcttgctggctcagctaaattccttgct
aacaagattggtgctgaacttggcatcaagactcgtgctatcgagctttcaacacttcag
cgttgtgcagctcatatgacaagccgtacagatatcacagaagcatacaacgttggtggt
gctgctgttaaggctgcatttgaaggcgagacaggtaaggttgttgttcttaagagagtt
tctgatgatccatatatgtgcatcacagagactaatgatgttcaccagattgctaacatc
gagaagaaagttcctcttgagtggattacagatgatgacttcgtaacagacgacctcatc
cactacatcagaccacttatccaggctgagctttcaccaatcatggtagacggtcttcca
agacatcttaatattaatgcataa

DBGET integrated database retrieval system