KEGG   Eubacterium eligens: EUBELI_00069Help
Entry
EUBELI_00069      CDS       T00908                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
eel  Eubacterium eligens
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:eel00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:eel00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
73740..75035
Genome map
AA seq 431 aa AA seqDB search
MEQYVVKGGVPLRGKVSIGGAKNAALGILAAAIMTDDTVTIENVPNVRDTRVLLQAIEGI
GAKVKYVYNNSVQINGGSICDTNVEYDYIRKIRASYYLLGALLGKYNEAHVALPGGCNIG
SRPIDQHIKGFKALGADVDIDCGVVHAKAEKLTGAHVYFDVVTVGATINLMMASCMAEGD
TILENAAKEPHIVDVANFLNSMGANIKGAGTDVIRIKGVKRLHGCTYSIIPDQIEAGTFM
MAAAATHGDVVIQDIIPKHMESISAKLIEMGCRIEEGDDSLRVIAEGCTLRSTNVKTLPY
PGFPTDMQPQISVVLALAEGSSMVTESIFENRFKYVDELGRMGAKIKVEGNTAYIEGVKS
FCGVQLNAPDLRAGAALVIAALAADGISEIDDIEYIQRGYEDFEGKITNLGGIIKRVDSE
RELQKFRLKIG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggaacaatatgttgtcaagggtggagtgccactcagaggaaaagtttccattggtggt
gcgaagaatgcagctttaggtattcttgcagcagcaattatgacagatgatactgtaaca
attgaaaatgtacctaatgttagagacacaagagttttacttcaggctatagaaggaatt
ggtgctaaggttaagtatgtttataacaattccgttcagataaatggtggttcaatctgt
gataccaatgtagaatatgattatataagaaaaataagagcatcttactatctgttaggt
gctttacttggtaagtacaatgaggctcatgttgcactcccaggaggatgcaatatcgga
agccgtccaattgaccagcatatcaagggctttaaggcacttggtgcggatgttgatata
gattgtggagttgtacatgcaaaggcagagaagcttacaggagctcatgtttattttgat
gttgtaacagttggtgcaacaattaaccttatgatggcttcatgtatggcagagggagac
actattctggaaaatgcggctaaggaaccgcatatagttgatgtagcgaatttccttaat
tctatgggtgctaacattaaaggtgcaggaactgatgtaatccgtatcaaaggcgttaag
agacttcacggatgtacttattctattattccggatcagattgaggccggaacatttatg
atggcagcagcagctacacatggtgatgttgttattcaggatattattcctaagcatatg
gaatcaatatctgcaaagttaattgagatgggatgcaggattgaggaaggtgatgacagc
ttaagagttatagcagagggctgtacacttaggagtactaatgttaagactttgccatat
cctggatttccaacggatatgcagccacagatttcagttgtacttgcacttgctgaaggt
tcaagtatggtaactgagagcatatttgagaacagattcaaatatgtagatgagcttgga
agaatgggtgccaagattaaggttgagggtaacacagcctatattgaaggtgttaaaagt
ttttgtggtgtgcagcttaatgctccggatttaagagctggtgcggcacttgttattgct
gcgctcgcagcagatggtatatcagagattgatgatattgagtatatccagagaggttat
gaggattttgaaggaaagattactaaccttggtggaattattaaaagagttgattcagag
agagaacttcagaagttcaggctcaagataggttaa

DBGET integrated database retrieval system