KEGG   Eubacterium eligens: EUBELI_00084Help
Entry
EUBELI_00084      CDS       T00908                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
eel  Eubacterium eligens
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    EUBELI_00084
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EUBELI_00084
Enzymes [BR:eel01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     EUBELI_00084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(91277..91888)
Genome map
AA seq 203 aa AA seqDB search
MGQITIEKNVAGIEGLCVITPAVHGDNRGYFMETYSQRDMEEAGININFVQDNQSMSTKG
VLRGLHFQKHFPQTKLVRAIKGAVFDVAVDLRTDSETYGKWYGILLTEENKKQFLIPKGF
AHGFLVLTDTAEFCYKCDDFYHPNDEGGLAWNDPAIGIEWPELTGTYNGSASGEGYALSD
GTKLNLSDKDQLWDTLENTFKFD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgggacagattacaattgaaaagaatgtcgcaggtatcgaaggactttgtgtcatcact
cctgctgttcacggcgataaccgtggttattttatggaaacatacagccaacgtgatatg
gaagaagctggtatcaatattaactttgttcaggacaatcagtctatgagtactaagggt
gttcttcgtggtcttcacttccagaagcatttcccacagacaaagcttgtaagagctatc
aagggagctgtttttgatgtagctgttgaccttcgtacagactctgaaacttatggaaag
tggtacggaatccttctcacagaggagaataagaagcagttccttatccctaagggattt
gcacatggattcctcgttcttactgatacagcggaattctgctacaagtgcgatgacttc
tatcatcctaacgacgagggtggtctcgcatggaatgaccctgcaatcggtattgaatgg
ccagagcttacaggcacttacaatggctcagcttcaggcgaaggctatgctttaagcgat
ggaacaaagctcaacttaagtgataaggatcagctttgggatacacttgagaacacattt
aagtttgattag

DBGET integrated database retrieval system