KEGG   Eubacterium eligens: EUBELI_00159Help
Entry
EUBELI_00159      CDS       T00908                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
eel  Eubacterium eligens
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:eel00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
187024..187890
Genome map
AA seq 288 aa AA seqDB search
MESIRLKARAKINLGLDVIGRRENGYHDVRMVMQTVGLYDRIIMTRIPEEEIRIKTNIGF
LPVNENNLVYKAIMLMKNKYKLDGGIEVDLNKFIPVAAGMAGGSSDAACALFGMNRLFEL
NVPMRELMKLGVEIGADVPYCLMRGTALAEGIGEKLTRLPDMPFCHILIAKPPVNVSTKL
VYEKLDNTDVKLHPDIDGIIEAIKLKDVALVASRMGNVLESVTIPLYPVIDSIKKDMIEH
GAINAMMSGSGPTVFGIFPDEQSMIACQQFLRQKGEARQVYTTETFTP
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtatcagattaaaggcaagagccaagattaatcttggacttgatgttattgga
agacgcgagaacggatatcatgatgtaagaatggtaatgcagactgttggtttgtatgac
cgtattataatgacaaggattccggaggaagagataagaattaagactaatataggattt
ctacctgtgaatgagaataatcttgtttataaggcaattatgcttatgaagaataagtat
aagctggatggtggaattgaggttgatcttaataaattcattccggttgcggcaggaatg
gctggaggttcaagtgatgcggcatgtgcattatttggaatgaacaggcttttcgaactt
aatgttccaatgagagagcttatgaagcttggtgttgagattggggcagatgttccatac
tgtcttatgagaggaacagcattagctgaaggaattggagagaagcttacaaggcttccg
gatatgccattttgtcatattcttatagcaaagcctccggtaaatgtatcaactaagctt
gtgtatgagaaactggataacacagatgttaagttgcatccagatatagatggaataatt
gaggctattaagttaaaggatgttgcacttgttgcttcaagaatgggaaatgttttagag
tcagttacaattccgttgtatcctgtcattgacagcattaagaaagatatgatagaacat
ggtgcaattaatgctatgatgagtggcagtggaccgacagtttttggaatatttccagat
gaacaatcaatgatagcctgtcagcagttcttaagacagaagggcgaggcaaggcaggtg
tatacaacggaaacatttacaccataa

DBGET integrated database retrieval system