KEGG   Eubacterium eligens: EUBELI_00159Help
Entry
EUBELI_00159      CDS       T00908                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
eel  Eubacterium eligens
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EUBELI_00159 (ipk)
Enzymes [BR:eel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     EUBELI_00159 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
187024..187890
Genome map
AA seq 288 aa AA seqDB search
MESIRLKARAKINLGLDVIGRRENGYHDVRMVMQTVGLYDRIIMTRIPEEEIRIKTNIGF
LPVNENNLVYKAIMLMKNKYKLDGGIEVDLNKFIPVAAGMAGGSSDAACALFGMNRLFEL
NVPMRELMKLGVEIGADVPYCLMRGTALAEGIGEKLTRLPDMPFCHILIAKPPVNVSTKL
VYEKLDNTDVKLHPDIDGIIEAIKLKDVALVASRMGNVLESVTIPLYPVIDSIKKDMIEH
GAINAMMSGSGPTVFGIFPDEQSMIACQQFLRQKGEARQVYTTETFTP
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtatcagattaaaggcaagagccaagattaatcttggacttgatgttattgga
agacgcgagaacggatatcatgatgtaagaatggtaatgcagactgttggtttgtatgac
cgtattataatgacaaggattccggaggaagagataagaattaagactaatataggattt
ctacctgtgaatgagaataatcttgtttataaggcaattatgcttatgaagaataagtat
aagctggatggtggaattgaggttgatcttaataaattcattccggttgcggcaggaatg
gctggaggttcaagtgatgcggcatgtgcattatttggaatgaacaggcttttcgaactt
aatgttccaatgagagagcttatgaagcttggtgttgagattggggcagatgttccatac
tgtcttatgagaggaacagcattagctgaaggaattggagagaagcttacaaggcttccg
gatatgccattttgtcatattcttatagcaaagcctccggtaaatgtatcaactaagctt
gtgtatgagaaactggataacacagatgttaagttgcatccagatatagatggaataatt
gaggctattaagttaaaggatgttgcacttgttgcttcaagaatgggaaatgttttagag
tcagttacaattccgttgtatcctgtcattgacagcattaagaaagatatgatagaacat
ggtgcaattaatgctatgatgagtggcagtggaccgacagtttttggaatatttccagat
gaacaatcaatgatagcctgtcagcagttcttaagacagaagggcgaggcaaggcaggtg
tatacaacggaaacatttacaccataa

DBGET integrated database retrieval system