KEGG   Eubacterium eligens: EUBELI_00226Help
Entry
EUBELI_00226      CDS       T00908                                 

Definition
exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
eel  Eubacterium eligens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eel00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EUBELI_00226
Enzymes [BR:eel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     EUBELI_00226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
252152..254074
Genome map
AA seq 640 aa AA seqDB search
MKYVEGFVENIIFRNEDNGYTVFNIVYDDEEITCVGVLSYINTGEFITAQGEFVKHAVYY
MQFKVTSYEFRAPDDAASVRRYLSSGAIKGIGEKMAERIVKTFGDDTFRIMEEEPERLAE
IKGISMSKAMDIANQLIDKKDIRKAMMFLQRYGIQMNLANKIFKRYGNDIYNILEQNPYR
LADDIEGVGFRTADEIASRAGIKIDSEFRIKSGIFYVLNQATMQGHTYLPYDKLVRQVNE
LLLIDVQDYDKYLMDLTMDKKIVVKVKDNVKCVYARMYYNMEANVAAMLNNLDVQIEEDQ
KFIDDRIARIEDKEGITLDDIQKEAVAKAVRNGLVIVTGGPGTGKTTTINTIIKYFELEG
LEIRLAAPTGRAAKRMTEACGYEAQTIHRMLEISGGVPEGDRKSAATGLSMFFERNEDNP
LEADVIIVDEMSMVDISIMNSLLKAVSIGTKLILVGDVDQLPSVGPGNVLKDIIESGCFP
VVKLERIFRQAAQSEIIINAHKINRGEEVVLNKYSKDFLFVHRNGADNIINAMKTLIKDK
LPDYVGADVYDLQILTPSRKSNVGVERLNKIMQDFLNPADAIKQERQVGDVTFREGDKVM
QIKNDYQLAWEKRSRYGIPTEQGTGAFNGDTGVIRENKHI
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatatgtagagggctttgtggagaatattatcttcaggaatgaagacaatggatat
acggtttttaatattgtatacgatgatgaagaaatcacctgtgttggagtgttaagctat
atcaacacaggtgaatttattaccgcacaaggcgaatttgttaagcatgcagtttactac
atgcagtttaaagtcacatcttatgagttcagagcgccggatgatgctgcatccgtaagg
cgttatctaagctccggggcaataaagggtatcggcgagaagatggctgaacgaatagtt
aagacatttggcgatgatacattcaggattatggaagaagaaccggagcgtctggctgag
attaaaggaataagcatgtctaaagctatggatatagcgaaccagcttattgacaagaaa
gacatcagaaaagcaatgatgtttcttcagcgttatggaatccagatgaatcttgccaac
aaaatatttaagcgttatggaaacgacatttataacattcttgaacagaatccgtacagg
cttgctgatgacatagagggtgtcggttttaggacggctgatgagattgcttcgcgtgcc
ggaatcaagattgattctgaattcaggattaagagcggaatattttatgtgcttaatcag
gcgacaatgcaggggcacacatatcttccgtatgataagcttgtgcgtcaggtaaacgaa
ttgcttttgattgatgttcaggattatgacaaatatcttatggacctgacaatggataag
aagatagttgttaaggttaaggacaatgtaaaatgtgtctatgcccgtatgtattacaac
atggaagcaaatgttgcagctatgcttaataatcttgacgtccagattgaggaagaccag
aaattcatagatgacaggattgcaaggattgaggataaagaaggaataactcttgatgat
atccagaaagaggctgttgcgaaagcagtaagaaacgggcttgttattgttactggcggt
ccgggaaccggtaagactacaactattaatacaataatcaaatattttgagctggaaggt
ctggaaatcaggctggcagcgcctacgggacgtgcagccaagagaatgacagaagcctgt
ggatatgaagcacagactatccacagaatgttagagataagcggcggcgttcctgagggt
gacagaaagtcggcggcaacagggctgtctatgttctttgagagaaatgaggacaatccg
cttgaagctgatgttattattgttgatgagatgtcaatggtagacattagcattatgaat
tcacttcttaaagctgtttcgattggaacaaaactgattcttgtaggtgatgtggaccag
cttccaagtgtaggtccgggaaatgtacttaaagacattatagaatccggatgttttccg
gttgttaagctggagaggatattcagacaggcggcacagagtgagattattattaacgcc
cataagataaacaggggtgaggaggtagtacttaacaagtacagcaaggattttctcttt
gttcacagaaacggtgctgacaatattataaatgcgatgaaaacgcttattaaggacaaa
cttccggactatgtaggtgccgatgtgtatgaccttcagattcttactccatcgcgaaaa
tccaatgtcggggtggaacgtcttaataagattatgcaggattttcttaatccggctgat
gctatcaagcaggaaagacaggtcggtgatgttactttccgtgaaggtgataaggttatg
cagattaagaatgactatcagcttgcatgggaaaaacgaagcagatacggtattccaaca
gaacagggaacgggcgcatttaacggggataccggagttattagagagaataagcacatt
tga

DBGET integrated database retrieval system