KEGG   Eubacterium eligens: EUBELI_00367Help
Entry
EUBELI_00367      CDS       T00908                                 

Definition
glycoside hydrolase family 77 protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
eel  Eubacterium eligens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EUBELI_00367
Enzymes [BR:eel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     EUBELI_00367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
397206..398822
Genome map
AA seq 538 aa AA seqDB search
MAETKFKRNAGILMPVSSLPSPYGIGTFGKDAYDFVTFVKECNHKYWQVLPLGPTTYGDS
PYQSYSAFAGNPYFVDLDMLIEEGFLLKSEVISRDWGDGIVPVNVSEDDAVNGRFGTYRD
GNIGDERYVSYEKIYNNRFDILRIAYDRFRDACAESKKTLAKGLPLYKQFDNFVKDNADW
LEDYALFMALKSHFNNVSWGEWETDIKFRKPEAMSQYEEQLSDDIGYWKFIQFEFYRQWN
ALKQYANSNGIEIIGDIPIYMGYDSVDVWANQGEFQLDENLTPIKVAGVPPDAFSDAGQK
WGNPLYDYDKMEANGFSWWRKRMAASAKLYDVIRIDHFIGIVKYYTIPSDMPDARQGEYR
QGPGQKLLDVINESIGDKKIIAEDLGVEVPEVAKILKENGYPGMKVLEFAFGGDRKNPHL
PYNYKQNLVCYGGTHDNETLLGFFEDRGDWELGYAYDYLDTRDKGRMVDQVFRAAYSSVA
VLTVFAVQDILKLGNWARMNLPSSMGNNWKWRMQKGQLGQHELECMRYLASVFDRERK
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaacgaaatttaaaagaaatgcaggtatacttatgccagtaagttcattgcca
tcaccatatggcataggaacatttggcaaggatgcatatgattttgttacatttgttaaa
gagtgtaatcataagtactggcaggtacttccgttaggaccaactacttatggtgacagc
ccatatcagtcatattctgcatttgcaggcaatccgtactttgttgatcttgatatgctt
attgaggaggggttcttgttaaagtcagaggttatttcaagagactggggcgatggaatt
gtgcctgtaaatgtttctgaagatgacgctgttaatggaagattcggaacctacagagat
ggaaatattggcgacgaaagatatgtcagttatgagaagatatataataacagatttgat
atattaagaattgcttacgacagatttagggatgcatgtgcagaaagcaagaagacgctt
gccaagggacttcctctttataagcagtttgataattttgttaaagataatgcagactgg
cttgaggattatgctctgtttatggcattaaagtctcactttaacaatgtctcatggggt
gaatgggaaactgatataaagttcagaaagccagaggcgatgagccaatatgaagaacag
ctttcggatgatataggatactggaaattcatacagtttgaattctacagacagtggaat
gcgcttaaacaatatgctaatagtaatggtatagagattataggtgatatacctatttat
atgggatatgacagcgtagatgtatgggctaatcagggagaattccagctggatgagaat
ttaacaccgataaaggttgcaggtgtaccgccagatgcattttctgatgcaggacaaaaa
tggggcaatcctctttatgattatgataaaatggaagcaaatggattcagctggtggaga
aagagaatggcagcctcagcaaagctgtatgatgtcataagaattgaccattttatagga
attgtgaagtactatacaattccatcagatatgcctgatgcaagacagggtgagtacaga
cagggaccgggacagaaactgcttgatgttattaatgaatctatcggtgataagaagatt
attgctgaagacttaggtgttgaagttcctgaagtggcaaagattcttaaagaaaatgga
tatccgggaatgaaggtccttgaatttgcatttggaggagatagaaagaatccgcatctt
ccatataattataaacaaaatcttgtgtgctatggtggaactcatgataacgaaaccttg
cttggtttctttgaagacaggggcgactgggaattaggatatgcttatgactatcttgat
acaagagataagggaagaatggttgaccaggtattcagggctgcgtattcaagcgttgct
gttcttacagtatttgctgttcaggacattctaaagcttggaaactgggcaagaatgaat
cttccatcaagcatgggcaataactggaaatggcgaatgcagaaaggtcagttaggccaa
catgaactggaatgcatgagatatcttgcaagtgtatttgatagagaaagaaagtaa

DBGET integrated database retrieval system