KEGG   Eubacterium eligens: EUBELI_00483Help
Entry
EUBELI_00483      CDS       T00908                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eel  Eubacterium eligens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EUBELI_00483
   01230 Biosynthesis of amino acids
    EUBELI_00483
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUBELI_00483
   00030 Pentose phosphate pathway
    EUBELI_00483
   00051 Fructose and mannose metabolism
    EUBELI_00483
   00052 Galactose metabolism
    EUBELI_00483
  Energy metabolism
   00680 Methane metabolism
    EUBELI_00483
Enzymes [BR:eel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EUBELI_00483
Protein phosphatases and associated proteins [BR:eel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EUBELI_00483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
492838..493914
Genome map
AA seq 358 aa AA seqDB search
MKIGMLTSGGDCQSLNAAMRGVAKTLYNNTNDVEIYGFLDGYKGMITKNYKLMKEEDFSG
ILTEGGTILGTSRTPFKYINEPDKEGRDKVAGMIKTYKDLKLDCLVMLGGNGSHKTAALL
SQKGLNVVTLPKTIDNDIEGTEMSFGFQSAIDVATRTIDEIHTTAASHSRVFIVEIMGHK
TGWLTLHSGIAGGADIILIPEIPYNVDEVLNTIRKREKQGKKFTIIAMAEGAISDEDAKL
SKKELKEKRKTYTFPSVAYQLSDELQKKAGQEVRVTIPGHVQRGGIPSASDRTLATRIGV
EAAGLILRKDYGNMVCIKEGKFSKIPLEEVAGKTKMVNVDNELIRQAESLGISLGRKA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaagataggtatgcttacaagtggtggagactgccagtctcttaatgcggcaatgaga
ggtgttgccaaaactttgtataataatacaaatgatgttgaaatatacggatttcttgat
ggttacaaaggaatgattactaagaattacaaactgatgaaagaagaggatttcagtggg
attctcacagagggaggaacaattcttggaacttccagaacacctttcaaatatattaat
gagcctgataaggaagggcgcgataaagttgcaggcatgattaagacttataaggattta
aaactcgactgcctggtaatgcttggcggaaacggttcacataagactgcggctctttta
tcgcagaagggtttaaatgttgttactcttcctaagactattgataatgatatagaagga
actgagatgagctttggatttcagtcagctatagatgttgcgacaagaactatagatgag
attcatacaacggcagcctcacacagcagagtgtttattgttgagattatgggacataaa
acaggctggctgacattgcattcaggaattgcaggcggtgctgatatcatacttatacct
gaaattccatataatgttgatgaggtgttgaatacaatcagaaagcgtgaaaagcagggt
aagaaatttactataatcgcaatggctgagggtgcaatatcagatgaggatgcaaagctg
tcaaagaaagagctgaaagaaaagagaaagacatatacatttccatcagtagcatatcag
ttgagtgatgagctgcagaaaaaagccggtcaggaggtaagagtaacaattcccggacat
gttcagcgtggcggaattccaagtgcatctgacagaacactggcaacaagaataggcgtt
gaggctgcaggacttatattaagaaaagattatggcaatatggtatgcatcaaagaagga
aagttctctaagataccacttgaagaggttgcaggtaaaacgaagatggttaacgtagat
aatgaacttataagacaggctgaaagcttaggcattagtcttggcagaaaggcataa

DBGET integrated database retrieval system