KEGG   Eubacterium eligens: EUBELI_00749Help
Entry
EUBELI_00749      CDS       T00908                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
eel  Eubacterium eligens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EUBELI_00749
Enzymes [BR:eel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     EUBELI_00749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
759430..760260
Genome map
AA seq 276 aa AA seqDB search
MGKYIYTYIENGQMYDKSPSFAELLAKEGLSCEKIVTGRIGYIRVENLLEKIKDAQWLVF
TSKNAVAGFAYNMGKMACEGEPDCDGVLNGDSVEAFGVRSGFPDGIKIAVVGNKTKEALR
TACGFEADFVSYKSTGLELGRSLMNIAAGKIVYLCAEVTSGSLEEAMKEYENLIKIPVYR
NEYVDTYAEYEMKDISDVSGIAVTSGSSGERIKWLIDRLGESGEVPVFSIGPACSRKLFE
AGVKKNRIIEACEHSYSGLVEAIKKSAGKPEAGIGR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgggtaaatacatatatacatatattgaaaacggacagatgtacgataaaagcccttcc
tttgcagaattacttgcaaaggaggggctttcctgcgaaaaaatagtgactggcaggatt
ggttatattcgtgtggagaatcttttggaaaagataaaagatgcacagtggcttgtgttt
acaagtaaaaatgctgtggctgggtttgcttataatatggggaagatggcttgtgaaggc
gagccggattgtgatggtgtgttgaatggagacagtgttgaagcttttggtgtgaggagc
gggtttcctgacggtattaagattgcggtagtcggcaataaaactaaagaagctctaaga
acggcatgcggttttgaggcagactttgtatcatataaatctacaggcttggaacttgga
aggagtctgatgaatattgcagccggcaagattgtatatctgtgtgccgaagtcacaagc
ggttcacttgaggaagctatgaaggagtatgaaaacttaattaagattccagtatatagg
aatgaatatgttgatacatatgcagagtacgaaatgaaagatatcagtgatgtctcagga
atagctgttaccagtggcagcagcggtgagagaataaaatggctgattgacaggcttggt
gagtcaggtgaagtcccagtgttcagcattggccctgcctgcagcagaaagctttttgag
gcgggcgtgaaaaagaataggataattgaagcttgtgagcatagctatagcgggctggtg
gaagcgattaagaagtcagcggggaagccggaagcgggaattggacgttag

DBGET integrated database retrieval system