KEGG   Eubacterium eligens: EUBELI_00834Help
Entry
EUBELI_00834      CDS       T00908                                 

Definition
hypothetical protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
eel  Eubacterium eligens
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:eel00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    EUBELI_00834
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    EUBELI_00834
Enzymes [BR:eel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     EUBELI_00834
Two-component system [BR:eel02022]
 CheA family
  CheA-CheYBV
   EUBELI_00834
Bacterial motility proteins [BR:eel02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    EUBELI_00834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
848063..849253
Genome map
AA seq 396 aa AA seqDB search
MAKKILVIDDSALMRRVISDIINEGNDYEVAAIAKDGLEGFDMIVSNPNLYSAIILDINM
PKMNGLELLQKLQKNHIEQTVIVVSTVAKEGAKETIQALEYGAFDFVTKPENYFETKGND
FKRRIHDMLNIATSSRASVERTKPAVSRITQSGSKLSSSLTSRLSSDKKASNDAISALRK
RNEVYDTLPPKVNPAKFTNIKSGTRKIVALACSTGGPKSLQQVIPMLPKNLDAGVVLVQH
MPAGFTASLAARLNEISDINVKEGADGDVIQKGWVYIAPGGKHIKVVKKAAEYVIKLNDE
PPIDGLRPCANVMYKSLVQCNYDEITCVVLTGMGADGTEGIKALSAGKKKIHVIAQDEES
CVVYGMPKAIAQTGLVDEVVPLNKIAETITKNVGVS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaaatccttgtaatagatgactctgcactcatgagaagagtaatatctgat
ataatcaatgaaggtaatgattatgaggttgctgcgattgcaaaggacggacttgaaggc
tttgatatgattgtttctaaccctaatctgtatagtgcgattattctggatatcaatatg
cctaagatgaatggccttgaattgttgcagaagttacagaaaaatcatattgaacagact
gttatagtagttagtacggttgccaaggaaggggctaaagaaaccattcaggccttggag
tatggagcttttgattttgtaactaagcctgagaattatttcgagactaagggtaatgat
tttaaaaggcgtattcatgatatgcttaatattgccacaagttcaagagcttcagtggaa
agaacaaaaccggcggtcagcagaataacacaatcaggcagtaagctgtcatcttctctg
acaagcaggctttcatcagataaaaaagcatctaatgatgcaatatctgcgttaagaaaa
agaaatgaggtttatgatacacttccacctaaagttaatcctgcaaagtttactaatatt
aagagtggaacaaggaagattgtggcacttgcgtgttcaaccggaggacctaaatcatta
caacaggtaataccaatgcttcctaagaatctggatgccggagtggtacttgtacagcat
atgccggcagggtttacagcatccttagcagccaggcttaacgaaataagtgatattaat
gttaaggaaggggcagatggtgatgttatacagaaaggctgggtatatattgcaccggga
ggaaaacatataaaagttgttaagaaggcagcagagtatgtgataaagcttaatgacgag
cctcctatagatggattaagaccatgtgccaatgtgatgtataaatcacttgtacagtgt
aattatgatgagattacatgtgttgtccttacaggaatgggagctgatggtacagaagga
ataaaagctctttcagcaggcaaaaagaaaatccatgttattgcacaggatgaggaaagc
tgtgttgtgtatggtatgcctaaggctattgcacagacaggactggttgatgaggttgtt
cctcttaataaaattgctgaaactataacgaagaatgtgggggtatcttaa

DBGET integrated database retrieval system