KEGG   Eubacterium eligens: EUBELI_00983Help
Entry
EUBELI_00983      CDS       T00908                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
eel  Eubacterium eligens
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EUBELI_00983
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EUBELI_00983
Enzymes [BR:eel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     EUBELI_00983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
999177..1000028
Genome map
AA seq 283 aa AA seqDB search
MGNYREFIKDKKRIVIKIGSSSLMHEQTGRLDLLKIEKLVRILIDIKNSGKDVVLVSSGA
IAVGRAVIGLCDRPTELPVKQACASIGQAKLMMVYQKIFAEYGAVASQVLLTKNTIVNDV
NRTNAQNTFNEILKLGAVPIVNENDTVSTYEIEQLQAFGDNDRLSAIVASIIGADLLILL
SDIDGLYTDDPNTNPNAKFVETVYEIDEKLMGMGKDSSGSNMGTGGMTTKLIAGKIATLS
GADMIITNGNDVDNIIRVMAGENVGTLFLDHRASDFDLMSLID
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggggaattatagagagtttataaaagacaagaaaagaattgttataaagataggttca
tcttcacttatgcatgagcagacaggcagattggaccttttaaagattgaaaagcttgta
aggattcttattgatattaagaattcaggaaaagatgttgttttagtttcttctggtgca
atagctgtgggaagggctgttataggactttgtgacagacctacagaacttccggtaaaa
caggcatgtgcatccataggacaggctaagttaatgatggtttaccagaagatatttgca
gaatatggtgcagttgcatcacaggttcttcttaccaagaacacaatagttaatgatgtt
aacaggactaatgcacagaatacatttaatgaaatcttaaagcttggggcagttccaatc
gttaatgagaacgatacagtatcaacttacgagattgaacagctacaggcttttggagat
aatgacagactttcagcaattgttgcttcaattatcggagcggaccttcttattctgtta
tctgatattgatggtctgtatacagatgatccaaacactaatcctaatgcaaaatttgtt
gaaactgtatacgagattgatgagaagcttatgggaatgggtaaagattcatccggcagt
aatatggggactggcggaatgacaaccaagcttattgcaggaaagattgcaacactgtcg
ggggcggatatgattattactaatggtaatgatgttgacaatattatcagggttatggct
ggggaaaatgttggaacattgttcttagaccacagagcatctgattttgacctgatgtct
cttatagattaa

DBGET integrated database retrieval system