KEGG   Eubacterium eligens: EUBELI_01304Help
Entry
EUBELI_01304      CDS       T00908                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
eel  Eubacterium eligens
Pathway
eel00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eel01100  Metabolic pathways
eel01110  Biosynthesis of secondary metabolites
eel01130  Biosynthesis of antibiotics
eel01230  Biosynthesis of amino acids
Module
eel_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EUBELI_01304
Enzymes [BR:eel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     EUBELI_01304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C CdhD ThiG FMN_dh His_biosynth UDPG_MGDP_dh_C
Motif
Other DBs
NCBI-ProteinID: ACR72301
UniProt: C4Z138
Position
complement(1341268..1342074)
Genome map
AA seq 268 aa AA seqDB search
MILDVIVEDKLKRLPEHKKRISEEEMTRLAIESQRVSHSFYDALAKDGLSIISEFKKASP
SHGNMNNKITLEKRIKQYGESADAISCLTEEDHFKGSTEYLKQIRQMTDLPIIRKDFIID
PYQVYEAKVIGADAVLLIAAILDDSRFKELYDLAYSLGLDVLCEVHNEEEMQRMLNLDVK
IIGINNRNLKTFEVDLDTTKKLADMVTPEMRKAGKLLVSESGVADTDDIKVLAKSGADAL
LIGTVLMEAPKPEELISEFKEVYNAERK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgatattagatgttattgtagaggataagttaaaaagacttccagaacacaagaaaaga
atcagtgaagaggagatgacaagacttgcgattgagagccagagagtgtcacacagcttc
tatgatgcacttgcaaaggacggcctttcaattataagtgagttcaagaaagcatcacca
agtcatggtaatatgaacaataagattactctggaaaaaagaataaaacagtacggcgaa
agcgcagatgctatttcatgtcttacagaggaagaccattttaagggaagtacagaatat
cttaagcagataagacagatgacagaccttccgattatcagaaaggatttcataattgat
ccatatcaggtgtatgaagcaaaggtaataggagcggatgcagttcttctcattgctgcg
attcttgatgacagtagatttaaagaactatatgaccttgcttacagtttaggacttgat
gttttatgcgaggttcataacgaagaggaaatgcagagaatgctgaatcttgatgtgaag
attataggaattaacaaccgtaatcttaagacatttgaggttgaccttgatactacgaaa
aaacttgcagatatggttacaccagagatgagaaaagctggaaaactgcttgtatcagaa
agcggtgttgcggatacagacgatattaaggtgctggcaaagagtggagcagatgcactt
cttataggaacagtgcttatggaagcaccgaagccggaagaattaatatcagagtttaaa
gaggtatataatgctgaaagaaaatga

DBGET integrated database retrieval system