KEGG   Eubacterium eligens: EUBELI_01680Help
Entry
EUBELI_01680      CDS       T00908                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eel  Eubacterium eligens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EUBELI_01680
   01230 Biosynthesis of amino acids
    EUBELI_01680
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUBELI_01680
   00030 Pentose phosphate pathway
    EUBELI_01680
   00051 Fructose and mannose metabolism
    EUBELI_01680
   00052 Galactose metabolism
    EUBELI_01680
  Energy metabolism
   00680 Methane metabolism
    EUBELI_01680
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    EUBELI_01680
Enzymes [BR:eel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EUBELI_01680
Protein phosphatases and associated proteins [BR:eel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EUBELI_01680
Messenger RNA biogenesis [BR:eel03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EUBELI_01680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1739116..1740090)
Genome map
AA seq 324 aa AA seqDB search
MAKEIKTIGVLTSGGDAPGMNAAIRAVVRTALNKGLKVKGIQKGYNGLLNDEIIDMDKRS
VADIIQRGGTVLYTARCMEFMTEEGQKRGAEVCRKHGIDGIVVIGGDGSFRGAQKLAAQG
INTIGLPGTIDLDIACTDYTIGFDTAVNTAMEAIDKIRDTSTSHERCSIIEVMGRNAGYI
ALWCGIANGAEDILLPERYDNDEQALINHIIEGRKKGKKHHLIINAEGIGHSTGMARRIE
AATGIETRATILGYMQRGGSPTCKDRMYASIMGAYAVDLLAEGKSNRLVAYRDGKFVDYD
IDEALAMTKDINDYEFNISALLSK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaattaaaacaatcggcgtattaacaagtggtggagatgctccaggcatg
aatgctgctatccgtgcagttgtaagaactgctttgaataagggacttaaggtcaagggt
attcagaagggctataacggacttcttaatgatgagataattgatatggacaagcgaagc
gttgctgatattatccagcgtggtggaacagtcctctatacagcacgatgcatggaattc
atgactgaagaaggtcagaagagaggtgctgaagtatgcagaaagcatggaattgacggt
atagttgtaatcggtggagatggttctttcagaggtgcacagaagcttgcagcacaggga
attaatactatcggacttccgggaacaattgatcttgatattgcatgtacagattatact
attggatttgatactgctgttaatacagcaatggaagctattgataagataagagataca
tctacatcacatgaaagatgcagtattatcgaggttatgggaagaaatgcaggatatatt
gcattgtggtgtggtattgccaatggtgcagaggatatccttcttcctgaaagatatgat
aatgatgagcaggctcttattaatcatattatagaaggaagaaagaagggcaagaaacac
catcttattattaatgctgaaggtatcggacattctacaggaatggcaagaagaattgaa
gctgcaacaggtattgagacaagagctactattttaggatacatgcagcgtggtggttca
ccaacatgtaaggacagaatgtatgcgtctattatgggtgcttatgctgttgaccttctt
gctgaaggaaagagtaacagacttgtagcatacagggatggtaagtttgttgattatgat
attgatgaagcacttgccatgactaaggatattaatgattatgaatttaatataagtgca
ttactttctaagtaa

DBGET integrated database retrieval system