KEGG   Eubacterium eligens: EUBELI_01781Help
Entry
EUBELI_01781      CDS       T00908                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
eel  Eubacterium eligens
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EUBELI_01781
   00670 One carbon pool by folate
    EUBELI_01781
Enzymes [BR:eel01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     EUBELI_01781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1842139..1842612
Genome map
AA seq 157 aa AA seqDB search
MIGLIVARSKNNVIGRNGEIPWKIKGEQKFFKELTIGNIVVMGRKSYEEIGHPLPNRQNI
IVSKTMKYEGENLITVSSLAEALALSDNSNIYIAGGYGVYKEAIPFVDVMYITEVDMNIE
DGDVFFPEFDVNDFDLIIGETFGENTKYTRTTYIRKK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgattggattgattgttgcaaggtcaaaaaataatgttattggtagaaatggtgagatt
ccttggaaaatcaaaggtgagcaaaaattttttaaggaacttacaatcggaaatattgta
gttatgggaagaaaatcttatgaagaaattggtcatccacttccaaatcgccaaaatata
atagtatcaaagacaatgaaatatgaaggcgaaaacctaattactgtatcatctttggca
gaagcattggcactttctgacaattcaaatatttatatagcaggagggtatggagtatac
aaagaggctatcccttttgttgatgtaatgtacattacagaagtagatatgaatatcgaa
gatggagatgtattttttccagagtttgatgtaaatgatttcgatttgattataggtgaa
acatttggcgagaatactaagtatacgaggactacatacataagaaagaagtag

DBGET integrated database retrieval system