KEGG   Eubacterium eligens: EUBELI_01906Help
Entry
EUBELI_01906      CDS       T00908                                 

Definition
indolepyruvate ferredoxin oxidoreductase, beta subunit
Orthology
K00180  
indolepyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.8]
Organism
eel  Eubacterium eligens
Brite
Enzymes [BR:eel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.8  indolepyruvate ferredoxin oxidoreductase
     EUBELI_01906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1970811..1971383)
Genome map
AA seq 190 aa AA seqDB search
MTKNIMIVGVGGQGTLLASKMLGYVLLKQGYDVKVSEVHGMSQRGGSVVTYVRYGEKVYS
PVIDKGEADVIISFEQLEAARWVEFLKKDGVIITNTQKMEPMPVITGAAEYPEGLIEKLT
AAGAKVDAKDFLALAEEAGSSKAVNIALMGRFSTYFPDITDEQWQDAIEKNVPAKFLELN
RKAFELGRNA
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaatattatgatagttggtgttggcggacagggaacacttcttgccagcaag
atgttaggatatgtattattaaagcagggatatgatgttaaggtttccgaggtacacgga
atgagccagagaggcggttcggttgtaacttatgtaagatacggcgagaaggtatattca
ccggtaatcgataaaggtgaggctgatgttatcatttcatttgagcagttagaggctgca
agatgggttgaattcttaaagaaagacggagttatcatcaccaatacgcagaagatggag
ccaatgcctgtaattacaggggcagcagagtatccggaaggacttattgagaagcttaca
gcagcaggcgccaaggttgatgcgaaggatttccttgcactcgctgaggaggcaggttct
tctaaggctgttaatatagcacttatgggaagattctcaacatacttccctgacataaca
gacgaacagtggcaggatgccatagagaaaaatgttcctgctaaattccttgagcttaac
aggaaggcatttgaactgggaagaaatgcttag

DBGET integrated database retrieval system