KEGG   Eubacterium eligens: EUBELI_02016Help
Entry
EUBELI_02016      CDS       T00908                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
eel  Eubacterium eligens
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:eel03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2087552..2088148)
Genome map
AA seq 198 aa AA seqDB search
MDIYSGHINRLIEELSRLPGVGAKSAQRLAFHIINMPESEVKSLADTMIDAKQHIHYCKE
CFTLTDEELCPICRDQKRDHKTIMVVEHTRDMAAYEKTGKYEGVYHVLHGAISPMLGIGP
ADIRLKELMVRLQGDVDEVIIATNSNLEGETTAMYISKMIKPTGIKVTRIASGVPVGGDL
EYIDEVTLLRALDGRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggacatctacagtggtcatattaacagattaattgaagaattgtcgagattaccaggg
gttggggcgaagagtgcccagcgcctggcatttcacattataaacatgcctgagtctgag
gttaagagccttgcagacacaatgattgatgcaaagcagcatattcactactgtaaggag
tgttttacacttacagatgaagaactgtgtccgatatgccgcgaccagaaaagagaccat
aagacaattatggtagttgaacatacaagagatatggcggcatatgaaaagacaggaaag
tacgagggcgtatatcatgttcttcatggagcaataagcccgatgcttggaatcggaccg
gctgatatcagattaaaggagcttatggtaaggcttcagggagatgttgacgaggttatt
atcgcaactaattccaatctggagggtgagacaacagcaatgtacataagcaaaatgata
aagccaacaggaattaaggtgacaagaattgcaagcggagttcctgtcggcggcgatctt
gaatatatcgatgaggttacacttttaagagcattagacggaagaaccgagctttaa

DBGET integrated database retrieval system