KEGG   Eubacterium eligens: EUBELI_02016Help
Entry
EUBELI_02016      CDS       T00908                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
eel  Eubacterium eligens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eel00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EUBELI_02016 (recR)
DNA repair and recombination proteins [BR:eel03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EUBELI_02016 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2087552..2088148)
Genome map
AA seq 198 aa AA seqDB search
MDIYSGHINRLIEELSRLPGVGAKSAQRLAFHIINMPESEVKSLADTMIDAKQHIHYCKE
CFTLTDEELCPICRDQKRDHKTIMVVEHTRDMAAYEKTGKYEGVYHVLHGAISPMLGIGP
ADIRLKELMVRLQGDVDEVIIATNSNLEGETTAMYISKMIKPTGIKVTRIASGVPVGGDL
EYIDEVTLLRALDGRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggacatctacagtggtcatattaacagattaattgaagaattgtcgagattaccaggg
gttggggcgaagagtgcccagcgcctggcatttcacattataaacatgcctgagtctgag
gttaagagccttgcagacacaatgattgatgcaaagcagcatattcactactgtaaggag
tgttttacacttacagatgaagaactgtgtccgatatgccgcgaccagaaaagagaccat
aagacaattatggtagttgaacatacaagagatatggcggcatatgaaaagacaggaaag
tacgagggcgtatatcatgttcttcatggagcaataagcccgatgcttggaatcggaccg
gctgatatcagattaaaggagcttatggtaaggcttcagggagatgttgacgaggttatt
atcgcaactaattccaatctggagggtgagacaacagcaatgtacataagcaaaatgata
aagccaacaggaattaaggtgacaagaattgcaagcggagttcctgtcggcggcgatctt
gaatatatcgatgaggttacacttttaagagcattagacggaagaaccgagctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system