KEGG   Eubacterium eligens: EUBELI_02054Help
Entry
EUBELI_02054      CDS       T00908                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
eel  Eubacterium eligens
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EUBELI_02054
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUBELI_02054
   00620 Pyruvate metabolism
    EUBELI_02054
   00650 Butanoate metabolism
    EUBELI_02054
  Lipid metabolism
   00071 Fatty acid degradation
    EUBELI_02054
  Amino acid metabolism
   00350 Tyrosine metabolism
    EUBELI_02054
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EUBELI_02054
   00626 Naphthalene degradation
    EUBELI_02054
Enzymes [BR:eel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EUBELI_02054
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EUBELI_02054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2125960..2128575
Genome map
AA seq 871 aa AA seqDB search
MSKNLTENYPIVDTVEALEERLAGVREAQRIFATYTQEQVDKIFTAAALAANKARIPLAK
LAVEETGMGIVEDKVIKNHYASEYIYNAYRNTKTCGVIEEDKAYGIKKVAEPIGVVAAVI
PTTNPTSTAIFKTLISLKTRNGIIISPHPRAKKSTIAAAKIVLEAAVAAGAPAGIIGWID
VPSLELTDTLMKEADIILATGGPGMVKAAYSSGKPALGVGAGNTPAIIDESADVILAVNS
IIHSKTFDNGMICASEQSVIVDKKVYKAVKEEFAYRGCYFLNKSETEKVRKTIIINGALN
AKIVGQKAHTIAALAGVTVPEETKILIGEVTSVDLSEEFAHEKLSPVLAMYKAEDFEDAL
SKAEHLIADGGFGHTSSLYINVETQADKIAEFSERMKTCRCLINTPSSHGGIGDLYNFKM
APSLTLGCGSWGGNSVSENVGVKHLLNVKTVAERRENMLWFRAPEKVYFKKGCLPVALDE
LGTVMGKKKAFIVTDQFLYKNGYTKCVTDKLDSLGIMHTTFYNVAPDPTLACAKEGTAAM
RLFEPDVIIAIGGGSAMDAAKIMWVMYEHPEADFLDMAMRFMDIRKRIYTFPKMGEKAYF
VAISTSSGTGSEVTPFAVITDETTGQKYPLADYELLPKMAIIDADMHMNQPKGLTAASGI
DALTHALEAYASIMATEYTDGLALQAMKNIFEYLPAAYELGAHDAVAREKMATASTMAGM
AFANAFLGVCHSLAHKLGAYHHLPHGIANALLITDVMRFNAAEVPTKMGTFSQYQYPHCK
ARYVECADFLGIQGKDDDEKFENLIKAIEELKAKVGIKKTIADYGVKEEDFLATLDEMTE
AAFDDQCTGANPRYPLMSEMKAMYLKAYYGK
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagaatttaactgagaattacccaattgttgacacagtcgaagctcttgaagaa
agacttgcaggtgtacgtgaggcacagcgcatctttgcaacctatacacaggagcaggta
gataagatatttactgctgctgcacttgctgccaataaagcaagaatccctcttgcaaag
cttgcagttgaagaaactggtatgggaattgtagaagataaggttatcaagaatcattat
gcttcagaatacatttataatgcttacagaaatactaagacatgtggtgttattgaagag
gataaggcatatggaattaaaaaagttgctgaacctattggcgttgttgcagccgtaatc
cctacaactaatccaacttcaacagctattttcaaaactcttatttcacttaagactaga
aatggtattatcataagcccacatccacgagctaagaaatcaacaattgcagcggctaag
attgttcttgaagctgctgttgcagcaggtgccccagcgggaatcattggctggatagat
gttccttcacttgaacttacagatacacttatgaaggaagctgacattatcctggctacc
ggaggacctggaatggttaaggctgcttactcttctggaaagcctgcacttggtgtaggt
gccggtaatactcctgctatcattgatgaatcagcagatgtaatacttgctgttaactca
attattcattctaagacatttgacaatggtatgatatgtgcttctgaacagtctgtaatt
gttgacaagaaggtttacaaggctgttaaagaagaatttgcatacagaggctgttacttc
cttaataagagcgagacagaaaaggtaagaaagaccattattatcaatggtgcccttaat
gcaaagattgttggtcagaaggctcacactatcgctgctttagcaggtgttactgttcct
gaagaaactaagattcttatcggtgaggtaacatctgtagacctttcagaagaatttgca
catgaaaagttatcacctgttcttgcaatgtataaggcagaggattttgaagatgctctt
tcaaaagctgaacaccttattgctgatggtggatttggtcatacatcttctctttatatt
aatgttgaaacacaggcagacaagattgctgaattctctgaaagaatgaagacatgccgc
tgccttatcaatacaccttcatctcacggtggaatcggtgacctctacaactttaagatg
gctccttctcttacacttggatgcggctcatggggcggcaactcagtatctgagaacgtt
ggagtaaaacatctgcttaatgtaaagactgtcgctgagaggagagagaatatgctttgg
tttagagcacctgagaaggtttactttaagaagggctgcttacctgttgcccttgatgaa
cttggaactgtaatgggtaagaagaaagcatttatcgttactgaccagttcctttataag
aatggttataccaaatgtgtcacagataagttagattctttaggaattatgcatactact
ttctataatgtagcaccagatccaacacttgcatgcgctaaagaaggcaccgcagccatg
agactttttgaacctgatgtaatcattgcaatcggtggtggttctgcaatggatgctgcc
aagattatgtgggttatgtatgaacatcctgaggcagacttccttgatatggctatgcgt
ttcatggatatcagaaagagaatatacacattccctaagatgggcgagaaagcttacttt
gtcgctatctcaacatcttctggaacaggttcagaggtaactccttttgcagttattact
gatgaaacaaccggtcagaaatatccacttgctgactatgaattacttcctaagatggct
attatcgatgctgacatgcatatgaatcagcctaagggacttacagcagcttctggtatt
gatgcacttacacatgcacttgaagcatacgcttccattatggcaacagaatatacagat
ggtcttgcattacaggctatgaagaatatatttgaatatcttccagcagcttatgaatta
ggtgcacatgatgcagttgcaagagaaaagatggcaacagcttctactatggctggtatg
gcttttgctaatgctttccttggagtgtgccactcacttgcacataaacttggtgcatat
caccaccttccacacggaattgctaatgcccttcttatcactgatgtaatgagattcaat
gctgcagaggttccaacaaaaatgggaacattctcacagtatcagtatccacattgcaaa
gcacgttatgttgagtgtgctgacttcctcggaattcagggtaaagatgatgatgagaaa
tttgaaaacctcatcaaggctattgaagaattaaaggcaaaggtaggaattaagaaaact
attgcagattatggtgttaaagaggaagacttccttgcaactcttgatgagatgacagaa
gccgcatttgatgaccagtgtactggtgctaacccaagatatcctcttatgagtgaaatg
aaagccatgtacttaaaggcttactatggtaaataa

DBGET integrated database retrieval system