KEGG   Eubacterium eligens: EUBELI_20134Help
Entry
EUBELI_20134      CDS       T00908                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eel  Eubacterium eligens
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    EUBELI_20134
Enzymes [BR:eel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     EUBELI_20134
Exosome [BR:eel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EUBELI_20134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p1:111019..112509
Genome map
AA seq 496 aa AA seqDB search
MAKYIMALDAGTTSNRCILFNRSGEMCSVAQKEFTQYFPKPGWVEHDADEIWSTILEVAR
QALANVGANASDIASIGITNQRETTVVWDRYSGEPVYNAIVWQCRRTSEYADSLKEKGLT
ETIRNKTGLVIDAYFSGTKLKWILDNVKGVRERAEKGDLLFGTIETWLIWKLTKGQVHAT
DYSNASRTMLFNINTLEWDEDILKELDIPKCMLPKAVPSSSIFGETSAEFFGCPIPIGGA
AGDQQAALFGQTCFDAGEAKNTYGTGCFLLMNTGEKPIFSKNGLVTTIAWGLDGKVTYAL
EGSIYVAGAAIQWLRDEMHFIDSSQDSEYMARKVPDTNGCYVVPAFTGLGAPYWDQYARG
TILGITRGVNKYHIIRATLESIAYQVNDVLTAMKADSGIELSSLKVDGGASANNLLMQMQ
ADISGAPVNRPVCVETTAMGAAYLAGLSVGYWKSTDDIRKNWSVDRTFDPEITQNERDSK
VRMWKKAVSYSFNWDK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatacataatggctcttgatgccggaacaacaagcaaccgctgtattcttttc
aacagaagtggcgagatgtgcagtgttgcacagaaagaattcacacaatatttcccaaaa
cctgggtgggtagaacatgatgcagatgaaatctggtcaacgattctggaagttgccaga
caggctcttgcaaatgtaggtgctaacgcgtcagatattgcctcaataggaataaccaac
cagcgtgaaacaacagttgtatgggacagatattctggtgagcctgtatacaatgctatt
gtatggcagtgcagaaggacttcagaatacgcagattctcttaaagagaaagggcttaca
gaaacaatccgtaacaaaaccggtcttgttattgatgcgtatttttctggaaccaagtta
aaatggattcttgataatgttaaaggtgtccgtgagcgtgccgaaaaaggagatctgctt
tttggaacaattgaaacatggttaatctggaagcttactaaaggtcaggttcatgccaca
gattattccaatgcatcaagaacgatgcttttcaacattaatacacttgaatgggacgaa
gacatcttaaaagagcttgatattccaaaatgcatgcttccaaaggcagtcccatcaagc
agcatatttggtgagacctccgctgaattcttcggctgtcctatcccaatcggaggtgct
gccggcgaccagcaggctgcacttttcggacagacctgttttgacgcaggagaagccaag
aatacatatggaacaggctgcttccttcttatgaatactggagaaaagcctattttttca
aagaacggtcttgttactactattgcatggggacttgacggtaaagtcacatatgcactt
gaaggctcgatatatgtagccggagctgccatccaatggcttcgtgacgaaatgcatttt
attgattcttcacaggattcggaatatatggcaagaaaagttcctgataccaacggatgc
tacgttgttcccgcatttacaggacttggtgcaccatactgggaccagtacgcaagaggt
actatcttaggaataacccgtggtgtcaacaaataccacattatacgtgccacacttgaa
tcaatcgcttatcaggtaaacgatgttcttactgcaatgaaagcagattcaggcatagaa
ctttcttctcttaaggtcgatggtggtgcaagtgctaacaatcttcttatgcagatgcag
gctgatatatccggtgctcctgtaaacaggcctgtatgtgttgaaacaactgccatgggt
gcggcttaccttgccggactctcagttggttactggaaaagtaccgatgacataagaaag
aactggtctgtagacagaacatttgaccctgaaatcactcagaatgagcgtgattccaag
gtcagaatgtggaaaaaagctgtctcttattcatttaactgggataaataa

DBGET integrated database retrieval system