KEGG   Eubacterium eligens: EUBELI_20137Help
Entry
EUBELI_20137      CDS       T00908                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
eel  Eubacterium eligens
Pathway
eel00790  Folate biosynthesis
eel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EUBELI_20137
Enzymes [BR:eel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     EUBELI_20137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI DUF285
Motif
Other DBs
NCBI-ProteinID: ACR73283
UniProt: C4Z7K5
Position
p1:complement(113838..114455)
Genome map
AA seq 205 aa AA seqDB search
MLSAQSLRGEARMEIMMIDTKAIEEHIRGILVALGDDPEREGLKDTPKRVAKMYEEVFLG
MNYSNHEIAQMFDKTFEDEIEELDTSKVVVMKDIDLFSYCEHHMALMYDMKATVAYIPNG
KVIGLSKIARICDMVGRRLQLQERIGQDIADIMAEITGSEDVAVVLEGYHSCVSARGIKK
NNTRTMTVELRGSFKDDAALQMYLR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgctttcagcccaaagtttgcggggtgaagcaagaatggagattatgatgatagatacg
aaagcgattgaggagcatattagagggattcttgttgcattgggcgacgacccggagaga
gagggcttaaaggatacaccaaagcgagttgcgaagatgtacgaggaggtctttcttggg
atgaattactccaatcatgaaattgcgcagatgtttgataagacatttgaggatgaaatt
gaggagcttgatacttctaaggttgtagttatgaaggacatcgacctgttttcttactgc
gagcaccatatggcacttatgtatgatatgaaggcgacagttgcgtacattcctaatggg
aaggttataggcttatcaaagattgcaagaatatgcgatatggttggaagaagactgcag
ttacaggaaagaatcggtcaggatattgcggacattatggcagagataacaggaagcgag
gatgttgcggtggtgcttgaaggatatcacagctgtgtgtcggcaagaggaattaagaaa
aacaacacgagaacaatgactgtagagttaagaggaagctttaaggacgatgcagcatta
caaatgtatctaagatag

DBGET integrated database retrieval system