KEGG   Eubacterium eligens: EUBELI_20137Help
Entry
EUBELI_20137      CDS       T00908                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
eel  Eubacterium eligens
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eel00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p1:complement(113838..114455)
Genome map
AA seq 205 aa AA seqDB search
MLSAQSLRGEARMEIMMIDTKAIEEHIRGILVALGDDPEREGLKDTPKRVAKMYEEVFLG
MNYSNHEIAQMFDKTFEDEIEELDTSKVVVMKDIDLFSYCEHHMALMYDMKATVAYIPNG
KVIGLSKIARICDMVGRRLQLQERIGQDIADIMAEITGSEDVAVVLEGYHSCVSARGIKK
NNTRTMTVELRGSFKDDAALQMYLR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgctttcagcccaaagtttgcggggtgaagcaagaatggagattatgatgatagatacg
aaagcgattgaggagcatattagagggattcttgttgcattgggcgacgacccggagaga
gagggcttaaaggatacaccaaagcgagttgcgaagatgtacgaggaggtctttcttggg
atgaattactccaatcatgaaattgcgcagatgtttgataagacatttgaggatgaaatt
gaggagcttgatacttctaaggttgtagttatgaaggacatcgacctgttttcttactgc
gagcaccatatggcacttatgtatgatatgaaggcgacagttgcgtacattcctaatggg
aaggttataggcttatcaaagattgcaagaatatgcgatatggttggaagaagactgcag
ttacaggaaagaatcggtcaggatattgcggacattatggcagagataacaggaagcgag
gatgttgcggtggtgcttgaaggatatcacagctgtgtgtcggcaagaggaattaagaaa
aacaacacgagaacaatgactgtagagttaagaggaagctttaaggacgatgcagcatta
caaatgtatctaagatag

DBGET integrated database retrieval system