KEGG   Eubacterium eligens: EUBELI_20473Help
Entry
EUBELI_20473      CDS       T00908                                 

Definition
(GenBank) fructose-1,6-bisphosphatase III
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
eel  Eubacterium eligens
Pathway
eel00010  Glycolysis / Gluconeogenesis
eel00030  Pentose phosphate pathway
eel00051  Fructose and mannose metabolism
eel00680  Methane metabolism
eel01100  Metabolic pathways
eel01110  Biosynthesis of secondary metabolites
eel01120  Microbial metabolism in diverse environments
eel01130  Biosynthesis of antibiotics
eel01200  Carbon metabolism
Module
eel_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUBELI_20473
   00030 Pentose phosphate pathway
    EUBELI_20473
   00051 Fructose and mannose metabolism
    EUBELI_20473
  Energy metabolism
   00680 Methane metabolism
    EUBELI_20473
Enzymes [BR:eel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     EUBELI_20473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos Tenui_NCP Metallophos_2
Motif
Other DBs
NCBI-ProteinID: ACR73618
UniProt: C4Z6M6
Position
p1:complement(434740..436617)
Genome map
AA seq 625 aa AA seqDB search
MKEYDKYLKLLKEKYPTKQSVYRELINLNAIMNLPKGTEHFMSDLHGEYDAFYHIINNCS
GVIREKVAMLYGDELTVYEQQELCTLIYYPREKLSILMDENKVNDEWYRNVLNQLIQIAK
LLSSKYTRSKVRKAMPVDFAYIIDELIHAQKDEDDNRSVYHRQIMETILSLHNGDEFLVA
LTDLIKRLAVDHLHILGDIYDRGPHADKILDLLMEHHSVDIQWGNHDILWMGAFCGNPVC
MALVVRNNIKYKTMSILENGYGISLRFLLQFAVNTYSDKNVDDAVYKAISVILFKLEGQL
IKRHPEYRMEGRLLLDKMNLDKGTVRIGDKEYFLNTTEFPTIDMNNPYELTMEEMFLMGR
FRADFINSMALERHINFLYEKGSIYKIHNGNLLFHGCVPLDEQGVFDGIVVDCKSYSGRE
YLDYCESMVRQARTRDSDAVDFMWFLWSNILSPVTGRCIKTFERTFLDKDRNADYKNAIK
EDKNPYYDLYENERICKMILREFNLYNESAHIINGHTPVRTKEGQHPVRANGKLIVIDGG
FCEGYHAATGIAGYTLIYNSHGMKIKEHHPFMSINMAINSNRDIESESQVVYVEKKRVFV
KDTDNGKQITEEINDLMNLLKLYNT
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaatacgataaatatctaaagttattaaaggaaaaatatcccacaaaacagtca
gtttaccgcgaacttattaacctgaatgcaattatgaatctgccaaagggaacagagcat
tttatgagtgaccttcatggggaatatgatgcattttaccatataattaataattgttcg
ggagtaattagagagaaggtagcgatgctgtatggagatgaacttactgtatatgagcag
caggagctgtgcactctgatatattatccaagagagaagctttctattcttatggatgag
aataaggtgaatgatgaatggtacagaaatgtacttaaccagctgattcagattgcaaag
cttctgtcttctaagtacacaagatctaaggtgcgaaaagcaatgcctgtggattttgca
tatatcattgatgagcttattcatgcgcagaaagatgaagatgacaataggagtgtgtac
cacaggcagattatggaaacaattctgagtcttcataatggtgatgaatttcttgttgca
cttaccgacttgattaaaagacttgccgtggatcatcttcatatactgggagacatatat
gacagaggaccacatgcagataagatattagatctactgatggaacatcacagtgttgat
atccagtggggaaatcatgatatattgtggatgggagctttttgtggcaatccggtgtgt
atggcacttgtagtcagaaataatattaagtataaaactatgtcgattcttgagaatggt
tatggaataagcctcaggttccttctacagtttgcagttaatacatattcagataaaaat
gttgatgatgcagtctataaagctatttctgtgattttattcaagcttgaagggcagctt
attaagagacacccggaatacaggatggaaggaagacttctgttggataagatgaatctg
gataaaggaacagtaagaattggtgataaggaatatttccttaatactacagaatttcca
accatagatatgaataatccatatgagcttactatggaagaaatgttcctaatgggaaga
ttcagggcagatttcattaacagtatggcacttgagaggcatatcaattttctatatgaa
aaaggcagcatttataagattcataatggaaatcttctgttccacggttgcgtgccactt
gatgaacaaggggtatttgatggaattgttgtggattgcaagtcgtattctggtcgtgag
tatcttgattattgcgaatcaatggtaaggcaggcaagaaccagagattcagatgcagtt
gattttatgtggtttttatggagtaatatattatcaccagtaaccggaaggtgtattaaa
acatttgaaagaacttttctggacaaggatagaaatgctgactataagaatgcaattaaa
gaggacaagaatccgtattatgacctgtatgagaatgaaagaatatgtaaaatgatttta
agagagtttaatctctacaatgagagtgcacatattataaatggacatactcctgtcagg
acaaaggagggacagcatccggtaagggctaatggcaaactgattgttatagatggcggt
ttttgcgaaggatatcatgctgccacaggaatagccggttatacacttatttataattct
catggaatgaagataaaagaacatcatccgtttatgagtattaatatggcaattaacagt
aacagggacattgagtctgaatcgcaggttgtttatgtggaaaagaagcgtgtgtttgta
aaggatactgataacggaaagcagattactgaagaaattaatgatctgatgaatcttttg
aaattgtataatacataa

DBGET integrated database retrieval system