KEGG   Eubacterium eligens: EUBELI_20587Help
Entry
EUBELI_20587      CDS       T00908                                 

Definition
Glycoside Hydrolase Family 5 candidate endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
eel  Eubacterium eligens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EUBELI_20587
Enzymes [BR:eel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     EUBELI_20587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p1:complement(556959..558569)
Genome map
AA seq 536 aa AA seqDB search
MMNKKKLCIIIVIAIIVTGLAVTFAVLSKSGKHKENVNEETTVNNEKQTDSVTEAAKADE
RKQVQTSVTMQFKQSNSWEGNGRFYAQYDLIIDNKEDVKISDWTFKINTTNGTTLEQSWN
CTVDTSDLQWSVVPVDYNKIIESQAQMNNVGFIISFASKEELKKYTLDFKLESGMEIVLA
DDGKAYKAGEEIADSSEESTVVENTASGDDTAQPGGSDSGNDSGNNSDTGSNAGIVTTVP
TGRLQVSGTKLTDESGNIIQLRGVSTHGISWFPDYVNYDAFATLRDDWGANVVRIAMYPE
EYNGYLSGGDKAALKQIIDNGVNYATELGMYVIIDWHVLNYAPSRHTQEACDFFAEMASK
YSGHDNVIYEICNEPVGADWNSDIKPYAETVIGTIRQFDDHALILVGTNTWSQDVDSVVG
NTLDDGNVMYVAHFYAGTHKENIRNKISTALNAGVPVFISECSICDASGNGGIDYASANE
WLDFMNSNQLSFIAWSLSNKAETSALISSGCSAKSGWSDGDLSETGRWFKSAISGR
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgatgaataaaaagaaattatgtataataatagttatagctataattgtaacaggatta
gctgttacatttgcagtattatcaaaatcaggtaaacataaagaaaatgttaatgaagaa
actacagtgaataacgagaaacagacagattctgtgacagaggcagctaaggcagatgag
agaaaacaggtacagacatctgtaacaatgcagtttaagcagtctaattcatgggagggc
aatggcagattctatgcacagtacgaccttattattgataataaggaggatgtaaagata
tcagactggacatttaagattaatactaccaatggcactacattggagcagagctggaat
tgtacagttgatacttcggatttacaatggagtgtcgtgccggttgattataataagata
attgagagtcaggcgcagatgaataatgtgggctttattatcagtttcgcgtctaaggag
gagcttaagaaatatacacttgatttcaagctggaatcgggaatggagatagtgcttgct
gatgatggaaaggcatataaagcgggagaagaaattgcagattcaagtgaagaatcaaca
gtggtggaaaatacagcatcaggagatgatacagcacagccgggtggaagtgattctgga
aatgattcaggaaataactctgatacaggaagcaatgcaggcatagtcacaacagttcca
acaggaagacttcaggtatccggcacgaaattaactgacgaatcaggtaacattatccag
ctaagaggggtaagtacacacggaatatcatggtttccagactatgttaattatgatgca
tttgcaaccttaagggacgattggggtgcaaatgtagtgagaattgctatgtatcctgaa
gaatataatggatatctttcaggtggagacaaagcggcattaaagcagattattgataac
ggtgttaattatgcaacagagcttggaatgtatgtaatcatagactggcatgtgcttaat
tatgcaccatcaagacacacacaggaggcatgtgatttctttgcagaaatggcatctaag
tattcaggccatgacaatgtaatatatgaaatatgtaatgaacctgttggtgctgactgg
aattcagacattaagccatatgcagagactgtaataggcacaataagacaattcgacgat
catgcacttatacttgtaggaactaacacatggtcacaggatgttgacagcgttgttggc
aatacgcttgatgatggaaatgttatgtatgtggcacatttttatgcaggaacacataaa
gaaaatataagaaataagataagcacagcacttaatgcaggagttccagtgtttatcagt
gaatgtagtatatgtgacgcatcaggcaatggtggaatagattatgcatctgccaacgag
tggcttgacttcatgaacagcaatcagctgagttttattgcatggagtcttagcaataag
gcagagacatcagcacttatatcatctggctgcagtgccaagagcggctggagtgatggt
gatttgtctgagacgggaagatggtttaagagtgcgatatcgggaaggtga

DBGET integrated database retrieval system