KEGG   Enterococcus faecalis V583: EF0066Help
Entry
EF0066            CDS       T00123                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
efa  Enterococcus faecalis V583
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:efa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EF0066 (ruvA)
Enzymes [BR:efa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EF0066 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
68667..69281
Genome map
AA seq 204 aa AA seqDB search
MYEYIIGKVTFVSPYYIVVETNGIGYQISVDNPYRYSGKMDTDIKLYLHQVVREDAQLLF
GFGSLEEKQLFLKLISVSGIGPKSGLAIMASVADHGGLINAIEGEDVTYLTKFPGVGKKT
AQQMILDLKGKLGELESSEAAVAAMTATEAVTTSNQALAEALEALSALGYSDREIKRITK
QLEALGETTTDVYLSNALKFMMKR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatatattattggaaaagtaacgtttgttagcccatactatattgtcgttgaa
acaaatggcattggctatcagatttcagtcgataacccgtatcgctattcaggaaaaatg
gatacggatattaaactatatcttcaccaagtcgtgcgggaagatgcacaacttttattt
ggttttggcagtttagaagaaaaacaattgttcttaaaattaatcagtgtctctggaatt
ggacctaaaagtggcttagctatcatggcttctgtggctgatcatggtggtttaatcaat
gcaattgaaggggaagatgttacatatttaacgaagttcccaggtgttggcaagaaaaca
gcccaacaaatgattttagatttaaaaggaaaattaggcgaattagagtcttccgaagca
gcggttgcggccatgaccgcaaccgaagcggtgacaacaagcaatcaagcattggcagaa
gcgttagaagcattaagtgccctaggctacagtgaccgagagattaagcgtatcactaag
caattggaagcgttaggtgagacaacgacagatgtttatttgagcaatgcgttaaaattc
atgatgaaacgctaa

DBGET integrated database retrieval system