KEGG   Enterococcus faecalis V583: EF0114Help
Entry
EF0114            CDS       T00123                                 

Definition
glycosyl hydrolase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
efa  Enterococcus faecalis V583
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EF0114
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EF0114
Enzymes [BR:efa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     EF0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
117533..120040
Genome map
AA seq 835 aa AA seqDB search
MNGVQKGMVFKVGNNLSTRKGENRETIVSWLGLSLLVGLAFILFSLFHQPMISQANEPTQ
EKHFMVYYRAWRDKTMQGVNTTLPDENWLTMHDIPYGIDIVNVFSYVPKGQEALAQPFYD
TLKNEYAPALHARGVRLVRGIDYSELLKVPYAGTTPTEAEFDAYAKELLTKFVDDLGIDG
LDIDMETRPSEKDIVLSNGVIRALSKYIGPKSGTDRPFLYDTNAEYLPPLQDVSDCFDFL
AYQQYGSDDQRTQRALNNLSPVLNGERFVPGLTFPEEQDRNRWYDTKEPYMESNMYKVAR
YSYENNLGGMFLYALDRDGRTYNEDDLNQIKPSNLLWTKTAIAESKGVSLAEMKAAAQHY
LKRISYANTDLEAQNKAAEAVTQATTLYDVNKAILGGDYGQGISNTYDAELEKGLLAIDL
TTLYRALDQAVTAIEKAESYTPETIQALQTTKETVATELAGKTYTAAQVTTWQTEVQTAL
DNLKEKQTQPLKSVFSIDAGRKYFSVEQLEELVAKASQNGYTDVQLILGNDGLRFILDDM
SVNVNGKKYNHNRVSKAIQRGNNAYYNDPNGNALTQKEMDRLLAFAKARNINIIPVINSP
GHMDALLVAMEKLAIKNPAFDGSKRTVDLGNQKAVNFTKAIISKYVAYFSAHSEIFNFGG
DEYANDVDTGGWAKLQSSGRYKDFVAYANDLAKIIKDAGMQPMSFNDGIYYNSDDSFGTF
DPEIIISYWTAGWSGYDVAKPEYFVQKGHKIFNTNDAWYWVAGNVDSGIYQYDDALANMS
KKAFTDVPAGSPNLPIIGSIQCVWYDDPRRDYDFERIYTLMDTFSENYREYMVVK
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgaacggagtgcagaaaggaatggtgttcaaagtggggaacaatttatcgacaagaaaa
ggagaaaacagagaaacaattgtcagttggctgggtctttcgttattggttggcttggcg
tttatcttatttagtctgtttcatcaaccaatgatcagccaagccaatgagccgacccaa
gagaaacattttatggtttattatcgggcttggcgtgacaaaacgatgcaaggagttaat
acaacattgccagatgaaaattggctaacgatgcacgatattccttatggtattgacatt
gtgaatgtctttagttatgtgccaaaaggacaagaagcacttgcacagccattttatgat
acgttaaaaaatgagtatgcgccagcactgcatgcacgaggtgttcgtttagttcgtggg
attgattacagcgagctattaaaagttccttatgcaggaacaacgcctacagaagcagaa
tttgatgcttatgcgaaagagttgttaaccaaatttgtcgatgatttaggaattgatggg
ttagatattgacatggaaactcgtccaagtgaaaaagatattgttctatctaatggtgtc
attcgtgcattatcaaaatacattggaccgaagtcgggaacggatcgtccatttttgtat
gataccaatgcagaatatttaccacctttacaagatgtcagtgactgtttcgattttctc
gcgtatcaacagtatggcagcgatgaccaacgcacgcaacgagcattaaataatttaagt
ccggttctcaatggggaacgatttgttccaggattaactttcccagaagagcaagatcgc
aaccgctggtatgacacaaaagagccgtatatggaaagtaacatgtataaagtagctcgt
tattcttatgaaaataatttagggggcatgttcctctatgccttagatcgcgatggtcgc
acctataatgaagacgatttaaatcagataaaaccttctaatttactttggacaaaaacg
gccattgcagagagtaaaggcgtttctcttgcagagatgaaagcggctgcgcaacactat
ttaaaacgaattagctacgccaacacagaccttgaagcacaaaataaagccgcagaagca
gtgacacaagcaacaacgctttatgatgtgaataaagctattttaggtggcgattatggc
caagggatttcaaacacctatgatgctgaattagaaaaaggcctgttagccattgactta
accactttatatcgtgcgttggatcaagcagttacagccattgaaaaggcagaaagctat
acaccagaaacgattcaagcactacaaacaacaaaagagacagtcgccacagaacttgcg
ggaaaaacgtatacagccgcacaagtgactacttggcaaacggaggtccaaacagctttg
gataatttaaaagagaaacaaacacaacctttaaaaagtgtcttttccattgatgcggga
agaaaatatttttccgtggagcaactggaagaattagtggccaaagctagtcaaaatggg
tacacagatgtccaattaattttaggaaatgatggcttacggtttatcttggatgatatg
tcggtcaatgtgaatggtaaaaaatacaaccacaaccgggtttcaaaagcaatccaacga
ggcaacaacgcatattacaatgatcctaatggcaacgcgttaacacaaaaagaaatggat
cggttgttggcttttgcgaaagcgcgcaacatcaacatcattcccgtgattaacagtcca
ggacatatggatgccttgttagtggccatggaaaaactagcgattaaaaatcccgctttt
gatggctcaaaacgaacagtagatttagggaaccaaaaggcagtgaatttcacaaaggcg
attatcagtaagtacgtggcttatttttccgcgcatagtgaaattttcaattttggcggc
gatgagtatgcaaatgatgtcgatacaggcggttgggcgaaactgcaatcttctgggcgc
tacaaagattttgtcgcttatgcgaatgatttagctaaaataattaaagatgcgggcatg
cagccaatgagcttcaatgatggcatttattacaacagcgacgattctttcggtacattt
gacccagagattattatttcttattggacagccggttggagcggatatgacgtagccaaa
cctgagtactttgttcaaaaaggacacaaaatttttaataccaatgatgcgtggtattgg
gtcgctggcaatgttgattctggcatttatcaatatgatgatgctttagcaaatatgtcg
aaaaaagcatttacagatgtgccagcaggtagcccgaatcttccaattattggaagtatt
caatgtgtttggtatgatgaccctcgtcgtgactatgattttgaacgaatttatacgcta
atggatacgttctcggaaaattatcgtgagtatatggtggttaaataa

DBGET integrated database retrieval system