KEGG   Enterococcus faecalis V583: EF0271Help
Entry
EF0271            CDS       T00123                                 

Gene name
arb
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
efa  Enterococcus faecalis V583
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:efa00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
258775..260205
Genome map
AA seq 476 aa AA seqDB search
MAFRKDFLWGGATAANQCEGGYNEGGRGLANVDLAPTGPDRFPVITGEKKMFNFDEEHFY
PAQEAIDMYHRYKEDIALFGEMGFKTYRLSIAWSRIFPMGDETEPNEEGLKFYEDLFKEC
HKYGIEPLVTITHFDCPMHLVEEYGAWRSRKLVGFYENLCRVIFNRYKGLVKYWLTFNEI
NMILHAPFMGAGLYFEEGENKEQVKYQAAHHELLASAIATKIAHEVDPENQVGCMLAAGS
NYAYTCKPEDVFAARQADRENYFFIDVQSRGEYPAYALKEMARKGIQIEMEEGDEELLKE
HTVDFISFSYYSSRVTSTDPEINEQTAGNIFASVKNPYLKASEWGWQIDPLGLRITMNDL
YDRYQKPLFIVENGLGAVDTPDENGDVVDDYRIDYLAAHIQAMKDAVEQDGVDLLGYTTW
GCIDLVSAGTGEMKKRYGFIYVDRDNEGNGTLKRSKKKSFDWYKKVIATNGEDLSN
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcatttagaaaagactttttatggggtggcgcaacagcagccaatcaatgtgaaggt
ggctataacgaaggcggacgtggtttggcaaacgtcgatttagcgccaactggtccagat
cgttttccagtaatcactggtgaaaagaaaatgtttaactttgatgaggaacatttctat
cctgcacaagaggcgattgatatgtatcatcgctataaagaagatatcgccttgtttggt
gaaatgggttttaaaacataccgtttatccattgcttggagtcgaatttttccaatggga
gatgaaacagagccgaatgaagaaggcttgaagttctatgaagacttattcaaagaatgt
cataaatatgggattgagccactagtaacgattacacactttgactgcccaatgcactta
gtggaagaatatggcgcttggcgtagtcgtaagttagtaggtttctatgaaaatctttgc
cgtgtaattttcaaccgatataaaggattagtcaaatattggttaacatttaacgaaatt
aatatgattttacatgcaccatttatgggagcaggtctatactttgaagaaggcgaaaac
aaagaacaagtgaaataccaagcggcccatcatgaactactagcaagtgcaattgcgaca
aaaattgctcatgaggtagatcctgaaaaccaagtaggttgtatgttagcggctggttcc
aactacgcttatacttgtaaaccagaagatgttttcgctgctcgacaagcagatcgtgaa
aattatttctttattgatgtccaatcacgtggggaataccctgcgtatgctttaaaagaa
atggcccgtaaaggtattcaaattgaaatggaagaaggcgacgaagaacttttaaaagaa
catacggtggacttcatttcgttctcttattattcttctcgtgtcacatcaacagatcca
gaaattaatgaacaaacagctggtaacatctttgcctctgtgaaaaatccttatttaaaa
gccagtgaatggggttggcaaattgatccgcttggtttgagaattacgatgaatgactta
tatgatcgttatcaaaaaccactattcattgttgaaaatggcttaggagcggtagacaca
ccagacgaaaatggtgatgtagtcgatgattatcgtatcgattatttggcggcgcatatt
caagcgatgaaagatgctgttgaacaagatggtgtcgacttgttaggctatacgacttgg
ggctgtattgatttagtatcagctggaacaggtgaaatgaaaaaacgctatggctttatc
tatgtggatcgcgataacgaaggaaatggtacgttaaaacgaagcaagaagaaatcgttt
gattggtacaaaaaagtaatcgcaacaaatggtgaagatttaagtaattaa

DBGET integrated database retrieval system